GlyCosmos Portal

Submissions

Rhodopsin

Summary

UniProt ID: A0A0G2JSY7
Gene Symbol: Rho rCG_29898
Gene ID: 24717
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: A0A0G2JSY7

Annotation

Keyword: Cell projection Disulfide bond G-protein coupled receptor Glycoprotein Lipoprotein Metal-binding Phosphoprotein Reference proteome Retinal protein Transmembrane helix Vision Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
visual perception	IEA	GO_REF GO_REF
phototransduction	IEA	GO_REF
response to light intensity
gene expression

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization

signal transduction [inference]

phototransduction

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

cellular component assembly [inference]

protein-containing complex assembly [inference]

podosome assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

podosome assembly

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

photoreceptor cell maintenance

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

locomotion [inference]

taxis [inference]

thermotaxis

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

thermotaxis

response to radiation [inference]

response to light stimulus [inference]

detection of light stimulus [inference]

phototransduction

cellular response to radiation [inference]

cellular response to light stimulus

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

detection of stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

phototransduction

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi apparatus	IEA	GO_REF
cell-cell junction	IEA	GO_REF
photoreceptor outer segment membrane	IEA	GO_REF
photoreceptor inner segment membrane	IEA	GO_REF
sperm midpiece	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

photoreceptor outer segment [inference]

rod photoreceptor outer segment

membrane [inference]

organelle membrane [inference]

photoreceptor disc membrane

bounding membrane of organelle [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

sperm midpiece

Displaying **all 3** entries
GO Term	Evidence Code	Reference
G protein-coupled receptor activity	IEA	GO_REF GO_REF
photoreceptor activity
metal ion binding

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

photoreceptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNGTEGPNFYVPFSNITGVVRSPFEQPQYYLAEPWQFSMLAAYMFLLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIGLWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTLKPEVNNESFVIYMFVVHFTIPMIVIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVIFFLICWLPYASVAMYIFTHQGSNFGPIFMTLPAFFAKTASIYNPIIYIMMNKQFRNCMLTTLCCGKNPLGDDEASATASKTETSQVAPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
2	N-linked (GlcNAc...) asparagine			UniProt
15	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements