GlyCosmos Portal

Submissions

Cathepsin D

Summary

UniProt ID: A0A2Y9SC19
Gene Symbol: CTSD
Gene ID: 102977235
Organism: Physeter macrocephalus (sperm whale)

External Links

Re-Glyco: A0A2Y9SC19

Annotation

Keyword: Aspartyl protease Disulfide bond Glycoprotein Lysosome Reference proteome Signal Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
autophagosome assembly
proteolysis	IEA	GO_REF GO_REF GO_REF
insulin receptor recycling	IEA	GO_REF
lipoprotein catabolic process	IEA	GO_REF
positive regulation of apoptotic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

protein metabolic process [inference]

proteolysis

protein catabolic process [inference]

lipoprotein metabolic process [inference]

lipoprotein catabolic process

insulin metabolic process [inference]

insulin catabolic process

receptor metabolic process [inference]

receptor recycling [inference]

insulin receptor recycling

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

protein catabolic process [inference]

lipoprotein metabolic process [inference]

lipoprotein catabolic process

insulin metabolic process [inference]

insulin catabolic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

vacuole organization [inference]

autophagosome organization [inference]

autophagosome assembly

organelle assembly [inference]

autophagosome assembly

cellular component assembly [inference]

organelle assembly [inference]

autophagosome assembly

execution phase of apoptosis

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization [inference]

regulation of establishment of protein localization

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

regulation of cellular process [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
lysosomal membrane	IEA	GO_REF
cytosol	IEA	GO_REF
endosome membrane	IEA	GO_REF
endosome lumen	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol

membrane [inference]

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

endosome membrane

membrane microdomain [inference]

membrane raft

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endosome lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

Displaying 1 entry
GO Term	Evidence Code	Reference
aspartic-type endopeptidase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

aspartic-type endopeptidase activity

aspartic-type peptidase activity [inference]

aspartic-type endopeptidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQTPCLLLLLALGLLAAPAAALVRIPLHKFTSIRRTMSEMGGPMEDLIAKGPISKYSQGVRTVTQGPIPEILKNYMDAQYYGEVGIGTPPQCFTVVFDTGSSNLWVPSVHCKLLDIACWTHHKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSGVLSRGSIKVERQTFGEATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDKNIFSFYLNRDPNAQPGGELMLGGTDPKYYKGSLIYHNVTRMAYWQVHMDQVDVGSGLTVCKGGCEAIVDTGTSLIVGPVEEVRELQKAIGAVPLIQGEYMIPCEKVSSLPKVTMKLGGRDYKLSPEDYTLKVSQAGRTMCLSGFMGMDIPPPGGPLWILGDVFIGRYYAVFDRDQNRVGLAEAARP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites