GlyCosmos Portal

Submissions

Paraoxonase

Summary

UniProt ID

A0A8I3PDF6

Gene Symbol

PON1

Gene ID

[475234]

Organism

Canis lupus familiaris (dog)

External Links

Re-Glyco: A0A8I3PDF6

Annotation

Keyword: Calcium Disulfide bond Glycoprotein Hydrolase Metal-binding Reference proteome Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cholesterol metabolic process
response to toxic substance	IBA	GO_REF
response to toxic substance	IEA	GO_REF GO_REF
positive regulation of cholesterol efflux	IEA	GO_REF
carboxylic acid catabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process

organophosphate metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process

organophosphate catabolic process

catabolic process [inference]

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

phospholipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process

steroid metabolic process [inference]

sterol metabolic process [inference]

cholesterol metabolic process

glycerolipid metabolic process [inference]

glycerophospholipid metabolic process [inference]

phosphatidylcholine metabolic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

secondary alcohol metabolic process [inference]

cholesterol metabolic process

organic acid metabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

carboxylic acid catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process

lactone metabolic process [inference]

lactone catabolic process

response to stimulus [inference]

response to chemical [inference]

response to toxic substance

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of sterol transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of cholesterol transport [inference]

regulation of cholesterol efflux [inference]

positive regulation of cholesterol efflux

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of lipid localization [inference]

regulation of lipid transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of sterol transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

regulation of cholesterol transport [inference]

regulation of cholesterol efflux [inference]

positive regulation of cholesterol efflux

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of biological process [inference]

positive regulation of transport [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

positive regulation of lipid localization [inference]

positive regulation of lipid transport [inference]

positive regulation of sterol transport [inference]

positive regulation of cholesterol transport [inference]

positive regulation of cholesterol efflux

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
spherical high-density lipoprotein particle	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

protein-lipid complex [inference]

lipoprotein particle [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

extracellular protein-containing complex [inference]

plasma lipoprotein particle [inference]

high-density lipoprotein particle [inference]

spherical high-density lipoprotein particle

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
aryldialkylphosphatase activity	IBA	GO_REF
aryldialkylphosphatase activity	IEA	GO_REF GO_REF
arylesterase activity	IBA	GO_REF
arylesterase activity	IEA	GO_REF GO_REF GO_REF GO_REF GO_REF
calcium ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphoric triester hydrolase activity [inference]

aryldialkylphosphatase activity

carboxylic ester hydrolase activity [inference]

arylesterase activity

lactonohydrolase activity [inference]

acyl-L-homoserine-lactone lactonohydrolase activity

binding [inference]

protein binding [inference]

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

lipid binding [inference]

phospholipid binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAKLMVLTLLGLGLALFRDHRASYLTRLNAFREVTPVELPNCNLVKGIETGSEDLEILPNGLAFISSGLRYPGIKSFEPDKPGKMLLVDLNEEDQTVLELKIIGSKFDEYSFNPHGISTFTDEDNTVYLLVVNHPDFKSTVEVFKFQEEEKSLLHLKTIRHKLLPNLNDIVAVGPEHFYATNDHYFTDVYLKSWELYLGLAWSYVVYYSPTEVQVMADGFDFANGINISPDGKYVYISELLAHKIHVYEKHANWTLTPLKSLDFNTLVDNISVDPVTGDLWVGCHPNGIRIFFYDSENPPASEVIRIQNILTEEPKVRVVYADNGTVLQGSTVASVYKGKLLVGTVFHKALCCEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
253	N-linked (GlcNAc...) asparagine	UniProt
270	N-linked (GlcNAc...) asparagine	UniProt
324	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Atorvastatin ADME	Canis familiaris
Synthesis of 5-eicosatetraenoic acids	Canis familiaris

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements