GlyCosmos Portal

Submissions

Angiopoietin-2

Summary

UniProt ID: A0A8J8
Gene Symbol: ANGPT2
Gene ID: 607616
Organism: Canis lupus familiaris (dog)

External Links

PubChem: A0A8J8
Re-Glyco: A0A8J8

Annotation

Keyword: Angiogenesis Calcium Coiled coil Developmental protein Differentiation Disulfide bond Glycoprotein Metal-binding Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IBA	GO_REF
angiogenesis	IEA	GO_REF
blood coagulation	IEA	GO_REF
gene expression
negative regulation of cell-substrate adhesion

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

Tie signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

cellular developmental process [inference]

cell differentiation

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

cellular developmental process [inference]

cell differentiation

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of chemotaxis [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

positive regulation of biological process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation

negative regulation of biological process [inference]

negative regulation of locomotion [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of chemotaxis [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of chemotaxis [inference]

negative regulation of positive chemotaxis

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of wound healing [inference]

negative regulation of blood coagulation

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

negative regulation of developmental process [inference]

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

Tie signaling pathway

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

regulation of cell-substrate adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-substrate adhesion

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of endothelial cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of blood vessel endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration [inference]

negative regulation of endothelial cell migration [inference]

negative regulation of blood vessel endothelial cell migration

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of coagulation [inference]

negative regulation of blood coagulation

positive regulation of coagulation

positive regulation of multicellular organismal process [inference]

positive regulation of coagulation

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of multicellular organismal development [inference]

regulation of vasculature development [inference]

regulation of angiogenesis [inference]

negative regulation of angiogenesis

negative regulation of vasculature development [inference]

negative regulation of blood vessel morphogenesis [inference]

negative regulation of angiogenesis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation

negative regulation of hemostasis [inference]

negative regulation of blood coagulation

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 4** entries
GO Term	Evidence Code	Reference
receptor tyrosine kinase binding	IBA	GO_REF
receptor tyrosine kinase binding	IEA	GO_REF
metal ion binding
receptor ligand activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

receptor tyrosine kinase binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein tyrosine kinase binding [inference]

receptor tyrosine kinase binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MWQIVFFTLSCDLVRAAAYNNFRRSMDSIGRRQYQVQHGSCSYTFLLPETDNCRSPGSYVPNAVQRDAPLDYDDSVQRLQVLENIMENNTQWLIKLENYIQDNMKKEMVEMQQNAVQNQTAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSEINKLQDKNSFLEKKVLDMEDKHIVQLRSIKEEKDQLQVLVSKQNSIIEELEKQLVTATVNNSVLQKQQHDLMETVHSLLTMISPSKSPKDTFVAKEEQIIYRDCAEVFKSGLTTNGIYTLTFPNSTEEIKAYCDMETSGGGWTVIQRREDGSVDFQRTWKEYKVGFGNPSGEHWLGNEFVFQVTNQQPYVLKIHLKDWEGNEAYSLYEHFYLSGEELNYRIHLKGLTGTAGKISSISQPGNDFSTKDADNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGSGYSLKGTTMMIRPADF

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
88	N-linked (GlcNAc...) asparagine	UniProt
118	N-linked (GlcNAc...) asparagine	UniProt
132	N-linked (GlcNAc...) asparagine	UniProt
150	N-linked (GlcNAc...) asparagine	UniProt
239	N-linked (GlcNAc...) asparagine	UniProt
303	N-linked (GlcNAc...) asparagine	UniProt