GlyCosmos Portal

Submissions

Noggin

Summary

UniProt ID: A2RTJ4
Gene Symbol: Nog
Gene ID: 18121
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: A2RTJ4

Annotation

Keyword: Chondrogenesis Developmental protein Differentiation Disulfide bond Glycoprotein Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
mesoderm development	IEA	GO_REF GO_REF
dorsal/ventral pattern formation	IEA	GO_REF
cell differentiation in hindbrain	IEA	GO_REF
neural plate anterior/posterior regionalization	IEA	GO_REF
negative regulation of cell migration	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

activin receptor signaling pathway [inference]

nodal signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

cell differentiation in hindbrain

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification [inference]

neural plate anterior/posterior regionalization

dorsal/ventral pattern formation

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

neural plate pattern specification [inference]

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

stem cell population maintenance [inference]

somatic stem cell population maintenance

developmental process [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

embryonic organ morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

skeletal system morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

embryonic morphogenesis [inference]

embryonic organ morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

anatomical structure development [inference]

tissue development [inference]

mesoderm development

animal organ development [inference]

cartilage development

cellular developmental process [inference]

cell differentiation [inference]

cell differentiation in hindbrain

maintenance of cell number [inference]

stem cell population maintenance [inference]

somatic stem cell population maintenance

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

activin receptor signaling pathway [inference]

nodal signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of cell differentiation [inference]

negative regulation of osteoblast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
growth factor binding	IEA	GO_REF
protein homodimerization activity	IEA	GO_REF
receptor ligand inhibitor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

growth factor binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

molecular function regulator activity [inference]

molecular function inhibitor activity [inference]

receptor ligand inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements