GlyCosmos Portal

Submissions

Neutral amino acid transporter A

Summary

UniProt ID: A2VDL4
Gene Symbol: SATT SLC1A4
Gene ID: 326577
Organism: Bos taurus (domestic cattle)

External Links

PubChem: A2VDL4
RaftProt: A2VDL4
Re-Glyco: A2VDL4

Annotation

Keyword: Acetylation Amino-acid transport Antiport Cell membrane Glycoprotein Metal-binding Phosphoprotein Reference proteome Sodium Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
L-glutamate transmembrane transport	IBA	GO_REF
L-serine transport	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

transmembrane transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

localization [inference]

establishment of localization [inference]

transport [inference]

amino acid transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

acidic amino acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

neutral amino acid transport [inference]

serine transport [inference]

L-serine transport

L-amino acid transport [inference]

L-serine transport

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

organic cation transport [inference]

serine transport [inference]

L-serine transport

organic anion transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-amino acid transport [inference]

L-serine transport

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

serine transport [inference]

L-serine transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

organic acid transport [inference]

carboxylic acid transport [inference]

dicarboxylic acid transport [inference]

L-glutamate import [inference]

L-glutamate transmembrane transport

L-amino acid transport [inference]

L-serine transport

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

serine transport [inference]

L-serine transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

transmembrane transport [inference]

amino acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

carboxylic acid transmembrane transport [inference]

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

nitrogen compound transport [inference]

L-amino acid transport [inference]

L-serine transport

L-glutamate import [inference]

L-glutamate transmembrane transport

L-alpha-amino acid transmembrane transport [inference]

L-glutamate transmembrane transport

serine transport [inference]

L-serine transport

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
melanosome

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

pigment granule [inference]

melanosome

Displaying **all 5** entries
GO Term	Evidence Code	Reference
L-alanine transmembrane transporter activity	IBA	GO_REF
L-aspartate transmembrane transporter activity	IBA	GO_REF
L-serine transmembrane transporter activity	IBA	GO_REF
L-threonine transmembrane transporter activity	IBA	GO_REF
symporter activity	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

amino acid transmembrane transporter activity [inference]

acidic amino acid transmembrane transporter activity [inference]

L-aspartate transmembrane transporter activity

neutral L-amino acid transmembrane transporter activity [inference]

L-threonine transmembrane transporter activity

alanine transmembrane transporter activity [inference]

L-alanine transmembrane transporter activity

L-amino acid transmembrane transporter activity [inference]

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

symporter activity

carboxylic acid transmembrane transporter activity [inference]

dicarboxylic acid transmembrane transporter activity [inference]

L-aspartate transmembrane transporter activity

L-amino acid transmembrane transporter activity [inference]

C4-dicarboxylate transmembrane transporter activity [inference]

L-aspartate transmembrane transporter activity

alanine transmembrane transporter activity [inference]

L-alanine transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEKSSETNGYLDSAQEGPAAGPGEPGTTARRAGRCAGFLRRHGLVLLTVSGVVAGAGLGAALRGLQLNRTQVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASSLGRLGGIAIAYFGLTTLGASALAVALAFIIKPGSGSQTLQSSDLGLEDSGPPPVPKETVDSFLDLTRNLFPSNLVVAAFRTYATDYREVTYNTSAGKVTIEKIPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEELIRFFNAFNEATMVLVSWIMWYVPVGIMFLVGSKIVEMKDIIMLVTSLGKYIFTSILGHFIHGGIVLPLIYFVFTRKNPFRFLLGLLTPFATAFATCSSSATLPSMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELRAGQIFTILVTATASSVGAAGVPAGGVLTIAIILEAIGLPTHDLSLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKAMKRGEQELSEVKVEAIPNSKSEEETSPLVTHPNPTGPAASTPESKESVL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
201	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Amino acid transport across the plasma membrane	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements