GlyCosmos Portal

Submissions

Sodium/potassium-transporting ATPase subunit beta

Summary

UniProt ID: A3KLL5
Gene Symbol: ATP1B1 ATP1B hCG_37798
Gene ID: 481
Organism: Homo sapiens (human)

External Links

GlycoProtDB: GPDB0008729
Re-Glyco: A3KLL5

Annotation

Keyword: Cell adhesion Cell membrane Disulfide bond Glutathionylation Glycoprotein Innate immunity Signal-anchor Sodium/potassium transport Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
response to hypoxia	IEA	GO_REF
intracellular calcium ion homeostasis	IEA	GO_REF
cell adhesion
regulation of gene expression	IEA	GO_REF
regulation of cardiac muscle contraction by calcium ion signaling	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

cell adhesion

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

multicellular organismal process [inference]

system process [inference]

muscle system process [inference]

muscle contraction [inference]

striated muscle contraction [inference]

cardiac muscle contraction

relaxation of muscle [inference]

relaxation of cardiac muscle

homeostatic process [inference]

cellular homeostasis [inference]

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

chemical homeostasis [inference]

monoatomic ion homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

monoatomic cation homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

intracellular chemical homeostasis [inference]

intracellular monoatomic ion homeostasis [inference]

intracellular monoatomic cation homeostasis [inference]

intracellular calcium ion homeostasis

inorganic ion homeostasis [inference]

calcium ion homeostasis [inference]

intracellular calcium ion homeostasis

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

response to hypoxia

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

potassium ion transport [inference]

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

sodium ion transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

transmembrane transport [inference]

monoatomic ion transmembrane transport [inference]

monoatomic cation transmembrane transport [inference]

sodium ion transmembrane transport [inference]

sodium ion export across plasma membrane

potassium ion transmembrane transport [inference]

potassium ion import across plasma membrane

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export across plasma membrane [inference]

sodium ion export across plasma membrane

import into cell [inference]

import across plasma membrane [inference]

inorganic ion import across plasma membrane [inference]

inorganic cation import across plasma membrane [inference]

potassium ion import across plasma membrane

export from cell [inference]

export across plasma membrane [inference]

sodium ion export across plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport

regulation of monoatomic ion transport [inference]

regulation of metal ion transport [inference]

regulation of calcium ion transport [inference]

regulation of calcium ion transmembrane transport

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction [inference]

intracellular signaling cassette [inference]

calcium-mediated signaling [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression

regulation of transmembrane transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of calcium ion transmembrane transport

regulation of multicellular organismal process [inference]

regulation of system process [inference]

regulation of muscle system process [inference]

regulation of muscle contraction [inference]

regulation of striated muscle contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of blood circulation [inference]

regulation of heart contraction [inference]

regulation of cardiac muscle contraction [inference]

regulation of cardiac muscle contraction by calcium ion signaling

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
sodium:potassium-exchanging ATPase complex	IEA	GO_REF GO_REF
caveola	IEA	GO_REF
intercalated disc	IEA	GO_REF
basolateral plasma membrane	IEA	GO_REF
apical plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

sodium:potassium-exchanging ATPase complex

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

transporter complex [inference]

transmembrane transporter complex [inference]

ATPase dependent transmembrane transport complex [inference]

cation-transporting ATPase complex [inference]

sodium:potassium-exchanging ATPase complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane [inference]

sarcolemma

plasma membrane region [inference]

plasma membrane raft [inference]

caveola

membrane microdomain [inference]

membrane raft [inference]

plasma membrane raft [inference]

caveola

cell junction [inference]

anchoring junction [inference]

cell-cell junction [inference]

cell-cell contact zone [inference]

intercalated disc

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ATPase activator activity	IEA	GO_REF
P-type sodium:potassium-exchanging transporter activity	IEA	GO_REF
protein kinase binding	IEA	GO_REF
protein heterodimerization activity	IEA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic cation transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

metal ion transmembrane transporter activity [inference]

potassium ion transmembrane transporter activity [inference]

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

sodium ion transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

active transmembrane transporter activity [inference]

primary active transmembrane transporter activity [inference]

active monoatomic ion transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

protein dimerization activity [inference]

protein heterodimerization activity

molecular function regulator activity [inference]

molecular function activator activity [inference]

ATPase activator activity

ATP-dependent activity [inference]

ATPase-coupled transmembrane transporter activity [inference]

ATPase-coupled monoatomic cation transmembrane transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type transmembrane transporter activity [inference]

P-type ion transporter activity [inference]

P-type sodium transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

P-type potassium transmembrane transporter activity [inference]

P-type sodium:potassium-exchanging transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
158				GlycoProtDB
193				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements