GlyCosmos Portal

Submissions

Tumor necrosis factor receptor superfamily member 11B

Summary

UniProt ID: A5D7R1
Gene Symbol: TNFRSF11B
Gene ID: 523822
Organism: Bos taurus (domestic cattle)

External Links

PubChem: A5D7R1
Re-Glyco: A5D7R1

Annotation

Keyword: Apoptosis Disulfide bond Glycoprotein Receptor Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
apoptotic process
signal transduction	IEA	GO_REF
negative regulation of tumor necrosis factor-mediated signaling pathway
extracellular matrix organization
negative regulation of odontogenesis of dentin-containing tooth

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell death [inference]

programmed cell death [inference]

apoptotic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of animal organ morphogenesis [inference]

regulation of odontogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of odontogenesis of dentin-containing tooth [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	IEA	GO_REF
signaling receptor complex	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying 1 entry
GO Term	Evidence Code	Reference
heparan sulfate binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

organic acid binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparan sulfate binding

sulfur compound binding [inference]

heparan sulfate binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNKLLCCALVFLDISIKWTTQETFPPKYLHYDPESSRQLMCDKCPPGTFLKQPCTARRKTVCAPCPDHYYTDTWHTSDECLYCSPVCKELQYVKQECSRTHNRVCECEEGRYLELEFCLKHRSCPPGFGVLHPGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSAFGLLLTQKGNATHDNICSGSSESSTHKCGIDMTLCEEAFFRFAVPTKLTPNWLSVLVDNLPGTKVNAESIERIKQRHNSREQTFQLLKLWKHQNKDQDMVKKIIQDIDLCENSVRRHIGHLNLTFEQLLKLMESLPGKKVTTEDVEKTVKTCKSSEQLLKLLSLWRIKNGDQDTRKGLLHALKHLKTYHFPKTVIQSLKKTIRFLHSFTMYRLYRKLFLEMIGNQVQSLKISCL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
165	N-linked (GlcNAc...) asparagine			UniProt
178	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
TNFs bind their physiological receptors	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements