GlyCosmos Portal

Submissions

Choline transporter-like protein 4

Summary

UniProt ID: A5PF08
Gene Symbol: CTL4 SLC44A4 TPPT1
Gene ID: 100124377
Organism: Sus scrofa (pig)

External Links

Re-Glyco: A5PF08

Annotation

Keyword: Antiport Cell membrane Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
acetylcholine biosynthetic process	ISS	GO_REF
choline transport	ISS	GO_REF
choline transport	IBA	GO_REF
positive regulation of cell growth	ISS	GO_REF
thiamine pyrophosphate transmembrane transport	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

acetylcholine metabolic process [inference]

acetylcholine biosynthetic process

biosynthetic process [inference]

acetylcholine biosynthetic process

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

neuromast hair cell development

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

export from cell [inference]

secretion by cell [inference]

signal release [inference]

acetylcholine secretion

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

otolith formation

anatomical structure development [inference]

cell development [inference]

neuron development [inference]

neuromast hair cell development

cellular developmental process [inference]

cell development [inference]

neuron development [inference]

neuromast hair cell development

localization [inference]

establishment of localization [inference]

transport [inference]

organic cation transport [inference]

acetylcholine transport [inference]

acetylcholine secretion

choline transport

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

organic anion transport [inference]

thiamine pyrophosphate transmembrane transport

organophosphate ester transport [inference]

thiamine pyrophosphate transmembrane transport

secretion [inference]

secretion by cell [inference]

signal release [inference]

acetylcholine secretion

vitamin transport [inference]

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

transmembrane transport [inference]

vitamin transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

nitrogen compound transport [inference]

quaternary ammonium group transport [inference]

thiamine pyrophosphate transmembrane transport

acetylcholine transport [inference]

acetylcholine secretion

choline transport

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

azole transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

pyrimidine-containing compound transmembrane transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

sulfur compound transport [inference]

thiamine transport [inference]

thiamine transmembrane transport [inference]

thiamine pyrophosphate transmembrane transport

export from cell [inference]

secretion by cell [inference]

signal release [inference]

acetylcholine secretion

acetate ester transport [inference]

acetylcholine transport [inference]

acetylcholine secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of growth [inference]

regulation of cell growth [inference]

positive regulation of cell growth

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of biological process [inference]

positive regulation of growth [inference]

positive regulation of cell growth

positive regulation of cellular process [inference]

positive regulation of cell growth

regulation of cellular process [inference]

positive regulation of cellular process [inference]

positive regulation of cell growth

regulation of cellular component organization [inference]

regulation of cell growth [inference]

positive regulation of cell growth

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF
apical plasma membrane	ISS	GO_REF
apical plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

plasma membrane region [inference]

apical plasma membrane

Displaying **all 4** entries
GO Term	Evidence Code	Reference
choline transmembrane transporter activity	ISS	GO_REF
antiporter activity
thiamine pyrophosphate transmembrane transporter activity	ISS	GO_REF
thiamine pyrophosphate transmembrane transporter activity	IBA	GO_REF

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

choline transmembrane transporter activity

organophosphate ester transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

quaternary ammonium group transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

active transmembrane transporter activity [inference]

secondary active transmembrane transporter activity [inference]

antiporter activity

vitamin transmembrane transporter activity [inference]

thiamine transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

azole transmembrane transporter activity [inference]

thiamine transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

sulfur compound transmembrane transporter activity [inference]

thiamine transmembrane transporter activity [inference]

thiamine pyrophosphate transmembrane transporter activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGEKQDPDKAYGKPAKYDPSFRGPIRNRSCTDIICCVLFFVFILGYIAVGLVAWVYGDPQQVLYPRNSSGAYCGIGENKDKPYLLYFNIFSCVLTTNIIAVAQNGLDCPTPQVCVSSCPAVSWTVATNQLSQTVGQVFYAANRSFCLPGVPGDMPVHQSLSQELCPSFLLPSSPALGRCFPWPNSTVPEVPEISNTSISQGISGLLDSLNARDISVKIFEDFAQSWYWILAALGVALVLSLLFVLLLRLVAGPLVFVLIIGVLGVLAYGIYHCWNEYRLLRDKGASISQLGFTTNLSAYSSVQETWLAALILLAVLEGILLLMLIFLRQRIRIAIALLEEASRAVGQMMSTLFYPLVTFVLLLVCIAYWAMTALYLATSGQPQYVLWAPNVSLAGCEKVMMNTSCDPMNQPVNSTCPGLMCVFQGYLSTGLVQRSLFNLQIYGVLGLFWTINWVLALGQCVLAGAFASFYWAFHKPRDIPTFPLSSAFIRTLRYHTGSLAFGALILTLVQIARAILEYIDHKLRGAQNPVARCIMCCFKCCLWCLEKFIKFLNRNAYIMIAIYGKNFCVSAKNAFMLLMRNIVRVVVLDKVTDLLLFFGKLLVVGGVGVLSFFFFTGRIQGLGKDFESPQLNYYWLPIMTSIMGAYVIASGFFSVFGMCVDTLFLCFLEDLERNDGSLDRPYYMSKALLKILGKKNEVPSGDKKRKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	Source
67	N-linked (GlcNAc...) asparagine	UniProt
142	N-linked (GlcNAc...) asparagine	UniProt
184	N-linked (GlcNAc...) asparagine	UniProt
195	N-linked (GlcNAc...) asparagine	UniProt
295	N-linked (GlcNAc...) asparagine	UniProt
390	N-linked (GlcNAc...) asparagine	UniProt
402	N-linked (GlcNAc...) asparagine	UniProt
413	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
SLC-mediated bile acid transport	Sus scrofa
Synthesis of PC	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements