GlyCosmos Portal

Submissions

Sialidase-1

Summary

UniProt ID: A6BMK7
Gene Symbol: NEU1
Gene ID: 505554
Organism: Bos taurus (domestic cattle)

External Links

PubChem: A6BMK7
Re-Glyco: A6BMK7

Annotation

Keyword: Carbohydrate metabolism Cell membrane Cytoplasmic vesicle Glycoprotein Glycosidase Lipid degradation Lysosome Phosphoprotein Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
ganglioside catabolic process	IBA	GO_REF
oligosaccharide catabolic process	ISS	GO_REF
oligosaccharide catabolic process	IBA	GO_REF
oligosaccharide catabolic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

lipid catabolic process [inference]

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

sphingolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

ceramide catabolic process [inference]

ganglioside catabolic process

carbohydrate catabolic process [inference]

oligosaccharide catabolic process

carbohydrate derivative catabolic process [inference]

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

oligosaccharide metabolic process [inference]

oligosaccharide catabolic process

carbohydrate catabolic process [inference]

oligosaccharide catabolic process

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside catabolic process

ceramide catabolic process [inference]

ganglioside catabolic process

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside catabolic process

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

sphingolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

ceramide catabolic process [inference]

ganglioside catabolic process

lipid catabolic process [inference]

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

sphingolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

ceramide catabolic process [inference]

ganglioside catabolic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside catabolic process

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative catabolic process [inference]

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside catabolic process

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

glycolipid catabolic process [inference]

glycosphingolipid catabolic process [inference]

ganglioside catabolic process

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	IBA	GO_REF
lysosome	ISS	GO_REF
lysosome	IBA	GO_REF
lysosome	IEA	GO_REF
lysosomal membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

membrane

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

vacuolar membrane [inference]

lytic vacuole membrane [inference]

lysosomal membrane

cell junction

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle

Displaying **all 3** entries
GO Term	Evidence Code	Reference
exo-alpha-sialidase activity	ISS	GO_REF
exo-alpha-sialidase activity	IBA	GO_REF
exo-alpha-sialidase activity	IEA	GO_REF GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on glycosyl bonds [inference]

hydrolase activity, hydrolyzing O-glycosyl compounds [inference]

alpha-sialidase activity [inference]

exo-alpha-sialidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MTEEGPGIVSLGKLRRPRMLRLWGICRVQIFSAIFMLMSPAGVGAGAKDDFSLVHPLVTMEQLLWVSGKQIGSVDTFRIPLITTTPRGTLLAFAEARKMSTSDKGAKFIALRRSMDQGSTWSPTAFIVDDGETPDGLNLGAVVSDTTTGVVFLFYSLCAHKAGCQVASTMLVWSKDDGVSWSSPRNLSLDIGTEMFAPGPGSGIQKQREPRKGRLIVCGHGTLERDGVFCLLSDDHGVSWRYGGGVSGIPYGQPKRENDFNPDECQPYELPDGSVVINARNQNNYHCHCRIILRSYDACDTLRPRDVTFDTELVDPVVAAGAVATSSGIVFFSNPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLTTLEGNVDGKDEAPQLYVLYEKGRNQYMESISLVKVSVYGTL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
186	N-linked (GlcNAc...) asparagine	UniProt
343	N-linked (GlcNAc...) asparagine	UniProt
352	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Glycosphingolipid catabolism	Bos taurus
Neutrophil degranulation	Bos taurus
Sialic acid metabolism	Bos taurus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements