GlyCosmos Portal

Submissions

Zinc metalloproteinase-disintegrin-like BmMP

Summary

UniProt ID: A8QL49
Organism: Bungarus multicinctus (many-banded krait)

External Links

Re-Glyco: A8QL49

Annotation

Keyword: Cell adhesion impairing toxin Disulfide bond Fibrinogenolytic toxin Glycoprotein Metal-binding Metalloprotease Platelet aggregation inhibiting toxin Secreted Signal Zinc Zymogen

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
proteolysis	IEA	GO_REF
venom-mediated hemorrhage	ISS	GO_REF
venom-mediated suppression of platelet aggregation	ISS	GO_REF
venom-mediated fibrinogenolysis	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

biological process involved in interspecies interaction between organisms [inference]

modulation of process of another organism [inference]

venom-mediated perturbation of biological process [inference]

venom-mediated perturbation of blood circulation [inference]

venom-mediated perturbation of hemostasis [inference]

venom-mediated depletion of circulating fibrinogen [inference]

venom-mediated fibrinogenolysis

Displaying **all 3** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
plasma membrane	IEA	GO_REF
host extracellular region	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

other organism part [inference]

host cellular component [inference]

host extracellular region

Displaying **all 4** entries
GO Term	Evidence Code	Reference
metalloendopeptidase activity	ISS	GO_REF
metalloendopeptidase activity	IEA	GO_REF
zinc ion binding	IEA	GO_REF
toxin activity

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

toxin activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIQALLVTICLAVFPYQGSSIILESGNVNDYEVVYPQKVPLLPKGGVQNPQPKTKYEDTVQYEFEVNGEPVVLHLERNKGLFSEDYTEAHYAPDGREITTRPPVQDHCYYHGYIQNEADSSAAISACDGLKGHFKHQGETYFIEPLKLSDSEAHAIYKDENVEEENETPKICGLTETTWESDEPIRNASLLIYTPEQNRYLKVKKYIEFYVAVDNRMYRHYKRNKPIIKRRVYELVNILNTILRRLNFHIALIGLEIWSKRDKINVQSDVKATLKSFGKWREKKLLPRKRNDNAQLLTRIDFNGNTVGLAALGSLCSVKYSVAVIQDYSKRTSMVASTMAHEMGHNLGINHDRASCTSCGSNKCIMATKRTKPASRFSSCSVREHQRYLLRDRPQCILNKPLITDIVAPAICGNYFVEVGEECDCGSPRDCRSACCNAATCKLKHEAQCDSGECCGKCKFKKVGAKCRAAKDDCDLPERCTGRSAECPTDIFRRNGLPCQNKQGYCYNGKCPTLTNQCIALMGPNVKVSRDSCFTLNQRGKGCGYCRMQNGAKIPCAAKDIKCGKLFCKKRNSGVCNCLILPDDPNYGMVETGTKCGDGMVCSDRKCVKLQTVY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites