GlyCosmos Portal

Submissions

Complement component C8 beta chain

Summary

UniProt ID

B7Z550

Gene Symbol

C8B
hCG_23458

Gene ID

732

Organism

Homo sapiens (human)

External Links

GlycoProtDB: GPDB0009215
Re-Glyco: B7Z550

Annotation

Keyword: Complement alternate pathway Disulfide bond EGF-like domain Glycoprotein Membrane attack complex Repeat Secreted Signal Target cell membrane Transmembrane beta strand

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
complement activation, alternative pathway
complement activation, classical pathway
killing of cells of another organism	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune effector process [inference]

complement activation [inference]

activation of immune response [inference]

complement activation [inference]

immune response [inference]

humoral immune response [inference]

complement activation [inference]

innate immune response [inference]

complement activation, alternative pathway

cellular process [inference]

cell killing [inference]

killing of cells of another organism

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, alternative pathway

disruption of anatomical structure in another organism [inference]

disruption of cell in another organism [inference]

killing of cells of another organism

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, alternative pathway

immune response [inference]

humoral immune response [inference]

complement activation [inference]

innate immune response [inference]

complement activation, alternative pathway

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, alternative pathway

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

complement activation, alternative pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

regulation of response to stimulus [inference]

positive regulation of response to stimulus [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

regulation of immune response [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

complement activation [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF GO_REF
membrane attack complex	IEA	GO_REF GO_REF
other organism cell membrane	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

pore complex [inference]

membrane attack complex

plasma membrane protein complex [inference]

membrane attack complex

cellular anatomical structure [inference]

extracellular region

other organism part [inference]

other organism cell membrane

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDTCMTLAFTLSGRFFMLLSQYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQVRCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGINLFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDFERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLEVAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVMNKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMVEDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFAYSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRKNTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
181				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements