GlyCosmos Portal

Submissions

Noggin

Summary

UniProt ID: B8XVN4
Gene Symbol: NOG
Gene ID: 574073
Organism: Sus scrofa (pig)

External Links

Re-Glyco: B8XVN4

Annotation

Keyword: Chondrogenesis Developmental protein Differentiation Disulfide bond Glycoprotein Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 75 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IEA	GO_REF
osteoblast differentiation	ISS	GO_REF
osteoblast differentiation	IBA	GO_REF
osteoblast differentiation	IEA	GO_REF
in utero embryonic development

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

activin receptor signaling pathway [inference]

nodal signaling pathway

smoothened signaling pathway

cell population proliferation [inference]

epithelial cell proliferation

cellular developmental process [inference]

cell differentiation [inference]

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

stem cell differentiation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

neuron projection guidance [inference]

axon guidance [inference]

motor neuron axon guidance

reproductive process [inference]

developmental process involved in reproduction [inference]

prostate gland epithelium morphogenesis [inference]

prostatic bud formation

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

cognition [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

pattern specification process [inference]

regionalization [inference]

anterior/posterior pattern specification [inference]

neural plate anterior/posterior regionalization

dorsal/ventral pattern formation

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

neural plate pattern specification [inference]

neural plate regionalization [inference]

neural plate anterior/posterior regionalization

behavior [inference]

learning or memory [inference]

learning [inference]

associative learning [inference]

visual learning

visual behavior [inference]

visual learning

exploration behavior

stem cell population maintenance [inference]

somatic stem cell population maintenance

developmental process [inference]

developmental process involved in reproduction [inference]

prostate gland epithelium morphogenesis [inference]

prostatic bud formation

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

embryonic organ morphogenesis [inference]

notochord morphogenesis

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

skeletal system morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

lung morphogenesis

tube morphogenesis [inference]

blood vessel morphogenesis [inference]

artery morphogenesis [inference]

pharyngeal arch artery morphogenesis

embryonic morphogenesis [inference]

morphogenesis of embryonic epithelium [inference]

embryonic organ morphogenesis [inference]

notochord morphogenesis

embryonic skeletal system morphogenesis [inference]

embryonic skeletal joint morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of embryonic epithelium [inference]

morphogenesis of an epithelial fold [inference]

morphogenesis of an epithelial bud [inference]

prostatic bud formation

lateral sprouting from an epithelium [inference]

prostatic bud formation

prostate gland epithelium morphogenesis [inference]

prostatic bud formation

muscle tissue morphogenesis [inference]

cardiac muscle tissue morphogenesis [inference]

atrial cardiac muscle tissue morphogenesis

ventricular cardiac muscle tissue morphogenesis [inference]

ventricular compact myocardium morphogenesis

face morphogenesis

trabecula morphogenesis [inference]

heart trabecula morphogenesis

anatomical structure formation involved in morphogenesis [inference]

formation of primary germ layer [inference]

endocardial cushion formation

tube formation [inference]

tube closure [inference]

neural tube closure

epithelial tube formation [inference]

embryonic epithelial tube formation [inference]

nephron tubule formation [inference]

mesonephric tubule formation [inference]

ureteric bud formation

animal organ formation [inference]

prostatic bud formation

anatomical structure development [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

tissue development [inference]

mesoderm development [inference]

axial mesoderm development

epithelium development [inference]

somite development

spinal cord development

animal organ development [inference]

gland development [inference]

pituitary gland development

cartilage development

cranial skeletal system development

cellular developmental process [inference]

cell differentiation [inference]

mesenchymal cell differentiation [inference]

epithelial to mesenchymal transition

stem cell differentiation

maintenance of cell number [inference]

stem cell population maintenance [inference]

somatic stem cell population maintenance

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

response to abiotic stimulus [inference]

response to radiation [inference]

response to light stimulus [inference]

visual behavior [inference]

visual learning

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of signaling [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission

regulation of growth [inference]

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of developmental growth [inference]

regulation of organ growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of locomotion [inference]

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

positive regulation of developmental process [inference]

positive regulation of kidney development [inference]

positive regulation of glomerulus development

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of multicellular organismal process [inference]

positive regulation of kidney development [inference]

positive regulation of glomerulus development

positive regulation of branching involved in ureteric bud morphogenesis

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of locomotion [inference]

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of growth [inference]

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of cartilage development

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of cartilage development

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of cellular response to growth factor stimulus [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

negative regulation of cellular response to growth factor stimulus [inference]

negative regulation of BMP signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of animal organ morphogenesis [inference]

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

regulation of cardiac epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of glial cell differentiation [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of astrocyte differentiation [inference]

negative regulation of astrocyte differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of developmental growth [inference]

regulation of organ growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

negative regulation of developmental growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of cartilage development

positive regulation of developmental process [inference]

positive regulation of kidney development [inference]

positive regulation of glomerulus development

positive regulation of morphogenesis of an epithelium [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of kidney development [inference]

positive regulation of kidney development [inference]

positive regulation of glomerulus development

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of glomerulus development [inference]

positive regulation of glomerulus development

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cartilage development [inference]

negative regulation of cartilage development

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

fibroblast growth factor receptor signaling pathway

cell surface receptor protein serine/threonine kinase signaling pathway [inference]

transforming growth factor beta receptor superfamily signaling pathway [inference]

BMP signaling pathway

activin receptor signaling pathway [inference]

nodal signaling pathway

smoothened signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

regulation of fibroblast growth factor receptor signaling pathway

regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of BMP signaling pathway [inference]

negative regulation of BMP signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

regulation of intracellular signal transduction [inference]

regulation of SMAD protein signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

regulation of trans-synaptic signaling [inference]

modulation of chemical synaptic transmission [inference]

regulation of synaptic plasticity [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

presynaptic modulation of chemical synaptic transmission

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of cardiac muscle cell proliferation

regulation of epithelial cell proliferation [inference]

positive regulation of epithelial cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

regulation of apoptotic signaling pathway [inference]

negative regulation of apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

regulation of cell differentiation [inference]

regulation of epithelial to mesenchymal transition [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

regulation of cardiac epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

regulation of osteoblast differentiation [inference]

negative regulation of osteoblast differentiation

regulation of glial cell differentiation [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of astrocyte differentiation [inference]

negative regulation of astrocyte differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of epithelial cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell communication [inference]

positive regulation of synaptic transmission [inference]

long-term synaptic potentiation

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription [inference]

negative regulation of transcription by RNA polymerase II

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of SMAD protein signal transduction

negative regulation of apoptotic signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of apoptotic signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of cell development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of osteoblast differentiation

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of cell motility [inference]

regulation of cell migration [inference]

negative regulation of cell migration

negative regulation of cell motility [inference]

negative regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of organ growth [inference]

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of kidney development [inference]

positive regulation of glomerulus development

positive regulation of branching involved in ureteric bud morphogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial to mesenchymal transition [inference]

negative regulation of cardiac epithelial to mesenchymal transition

negative regulation of organ growth [inference]

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of cartilage development

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in ureteric bud morphogenesis [inference]

positive regulation of branching involved in ureteric bud morphogenesis

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

regulation of neurogenesis [inference]

regulation of gliogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

negative regulation of nervous system development [inference]

negative regulation of neurogenesis [inference]

negative regulation of gliogenesis [inference]

negative regulation of glial cell differentiation [inference]

negative regulation of astrocyte differentiation

regulation of heart growth [inference]

regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cardiac muscle cell proliferation [inference]

negative regulation of cardiac muscle cell proliferation

negative regulation of heart growth [inference]

negative regulation of cardiac muscle tissue growth [inference]

negative regulation of cardiac muscle cell proliferation

regulation of cartilage development [inference]

negative regulation of cartilage development

regulation of biological quality [inference]

regulation of synaptic plasticity [inference]

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
presynapse	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

presynapse

Displaying **all 3** entries
GO Term	Evidence Code	Reference
growth factor binding	IEA	GO_REF
protein homodimerization activity	IEA	GO_REF
receptor ligand inhibitor activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

growth factor binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

molecular function regulator activity [inference]

molecular function inhibitor activity [inference]

receptor ligand inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERCPSLGVTLYALVVVLGLRAAPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAPGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
62	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Signaling by BMP	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements