GlyCosmos Portal

Submissions

Ribonuclease T2-A

Summary

UniProt ID: C0HKG5
Gene Symbol: Rnase6pl Rnaset2a Rnaset2b
Gene ID: 100037283 68195
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: C0HKG5

Annotation

Keyword: Disulfide bond Endonuclease Endoplasmic reticulum Glycoprotein Innate immunity Lyase Lysosome Mitochondrion Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
RNA catabolic process	ISO	GO_REF
RNA catabolic process	IEA	GO_REF
innate immune response	ISS	GO_REF
innate immune response	ISO	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

innate immune response

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process

nucleic acid catabolic process [inference]

RNA catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleic acid catabolic process [inference]

RNA catabolic process

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

RNA catabolic process

nucleic acid catabolic process [inference]

RNA catabolic process

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	IEA	GO_REF
obsolete extracellular space
mitochondrial intermembrane space	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

vacuolar lumen [inference]

lysosomal lumen

endoplasmic reticulum lumen

organelle envelope lumen [inference]

mitochondrial intermembrane space

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	IEA	GO_REF
RNA endonuclease activity
RNA nuclease activity	ISO	GO_REF
hydrolase activity
ribonuclease T2 activity	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity

lyase activity [inference]

phosphorus-oxygen lyase activity [inference]

ribonuclease T2 activity

catalytic activity, acting on a nucleic acid [inference]

nuclease activity [inference]

endonuclease activity [inference]

RNA endonuclease activity

ribonuclease T2 activity

RNA nuclease activity

RNA endonuclease activity

ribonuclease T2 activity

catalytic activity, acting on RNA [inference]

RNA nuclease activity

RNA endonuclease activity

ribonuclease T2 activity

binding [inference]

nucleic acid binding [inference]

RNA binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPAEARGALPGWISVLGWGLALCSLCGAGPLWSGSHEWKKLILTQHWPPTVCKEVNSCQDSLDYWTIHGLWPDRAEDCNQSWHFNLDEIKDLLRDMKIYWPDVIHRSSNRSQFWKHEWVKHGTCAAQVDALNSEKKYFGKSLDLYKQIDLNSVLQKFGIKPSINYYQLADFKDALTRIYGVVPKIQCLMPEQGESVQTVGQIELCFTKEDLHLRNCTEPGEQLSSRQEAWLAMEASTHGMMVCEDGPIFYPPPTKTQH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	Source
80	N-linked (GlcNAc...) asparagine	UniProt
110	N-linked (GlcNAc...) asparagine	UniProt
216	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Neutrophil degranulation	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements