GlyCosmos Portal

Submissions

Palmitoleoyl-protein carboxylesterase notum1a

Summary

UniProt ID: C5H5C4
Gene Symbol: notum1a
Gene ID: 570510
Organism: Danio rerio (zebrafish)

External Links

PubChem: C5H5C4
Re-Glyco: C5H5C4

Annotation

Keyword: Glycoprotein Reference proteome Secreted Serine esterase Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
anterior/posterior pattern specification	IMP	PMID
Wnt signaling pathway
neural tube patterning	IMP	PMID
negative regulation of Wnt signaling pathway	ISS	GO_REF
negative regulation of Wnt signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoleylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

macromolecule modification [inference]

protein modification process [inference]

protein deacylation [inference]

protein depalmitoleylation

macromolecule deacylation [inference]

protein deacylation [inference]

protein depalmitoleylation

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

protein modification process [inference]

protein deacylation [inference]

protein depalmitoleylation

lipoprotein metabolic process [inference]

lipoprotein catabolic process [inference]

protein depalmitoleylation

multicellular organismal process [inference]

pattern specification process [inference]

regionalization [inference]

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of Wnt signaling pathway [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

regulation of canonical Wnt signaling pathway [inference]

negative regulation of canonical Wnt signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of Wnt signaling pathway

negative regulation of canonical Wnt signaling pathway

Displaying **all 2** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying **all 3** entries
GO Term	Evidence Code	Reference
GPI anchor phospholipase D activity	IDA	PMID
palmitoleyl hydrolase activity	ISS	GO_REF
palmitoleyl hydrolase activity	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

D-type glycerophospholipase activity [inference]

GPI anchor phospholipase D activity

phosphoric ester hydrolase activity [inference]

phosphoric diester hydrolase activity [inference]

D-type glycerophospholipase activity [inference]

GPI anchor phospholipase D activity

carboxylic ester hydrolase activity [inference]

palmitoleyl hydrolase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKRSLWVMQVLHWAVMLALVQCGALGARRFRGGRNPQPRRALPSAHYRDRGETTESFSLDFTAVEENMDNFMTQVKNLAQSLYPCSAQKLDYDMKLHFLENTSVTCNDGTPAGYYLKESKGSKRWLIFLEGGWYCFNKENCDSRYETMRRLMSSSKWPQTKTGTGMLSSLPEENPHWWNANMVFIPYCSSDVWSGASPKTDQNDYAFMGSLIIKEVVKDLLSKGLDNAKILLLAGSSAGGTGVLLNVDSVSELLEELGHTNIQVRGLSDSGWFLDNKQYRCTDCVDTINCAPTEVIKRGIKYWGGVVPERCRQAYEGKEWNCFFGYKVYPTIKRPVFIVQWLFDEAQLTVDNIHLTGQPVQEGQWRYIQNLGTELRNTLKDVPAMFAPACLSHEFITRNYWTDVQVKGTSLPRALHCWDRSLQDTSRNNKSPPKGCPVHLIDSCPWPHCNPTCPTIRDQSTGQEMNVIQFLMHMGFDVQKMAHQQGMDPSKLLGMLSSGS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
101	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Post-translational protein phosphorylation	Danio rerio
Regulation of IGF Activity by IGFBP	Danio rerio
Release of Hh-Np from the secreting cell	Danio rerio

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements