GlyCosmos Portal

Submissions

Coagulation factor XI

Summary

UniProt ID: D6RB32
Gene Symbol: F11
Gene ID: 2160
Organism: Homo sapiens (human)

External Links

GlycoProtDB: GPDB0009726
Re-Glyco: D6RB32

Annotation

Keyword: Blood coagulation Disulfide bond Glycoprotein Proteomics identification Reference proteome Repeat Secreted Serine protease Signal Zymogen

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
blood coagulation
plasminogen activation	IEA	GO_REF
positive regulation of fibrinolysis	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

protein maturation [inference]

protein processing [inference]

zymogen activation [inference]

plasminogen activation

multicellular organismal process [inference]

coagulation [inference]

blood coagulation

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of fibrinolysis

negative regulation of biological process [inference]

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of fibrinolysis [inference]

positive regulation of fibrinolysis

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of response to stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of response to stress [inference]

regulation of response to wounding [inference]

regulation of wound healing [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of fibrinolysis [inference]

positive regulation of fibrinolysis

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of response to wounding [inference]

negative regulation of wound healing [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of multicellular organismal process [inference]

regulation of coagulation [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of fibrinolysis [inference]

positive regulation of fibrinolysis

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

negative regulation of multicellular organismal process [inference]

negative regulation of coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of fibrinolysis [inference]

positive regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of biological quality [inference]

regulation of body fluid levels [inference]

hemostasis [inference]

blood coagulation

regulation of hemostasis [inference]

regulation of blood coagulation [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

regulation of fibrinolysis [inference]

positive regulation of fibrinolysis

negative regulation of hemostasis [inference]

negative regulation of blood coagulation [inference]

positive regulation of fibrinolysis

Displaying 1 entry
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

Displaying 1 entry
GO Term	Evidence Code	Reference
serine-type peptidase activity

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

serine-type peptidase activity

serine hydrolase activity [inference]

serine-type peptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

serine-type peptidase activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MIFLYQVVHFILFTSVSGECVTQLLKDTCFEGGDITTVFTPSAKYCQVVCTYHPRCLLFTFTAESPSEDPTRWFTCVLKDSVTETLPRVNRTAAISGYSFKQCSHQISACNKDIYVDLDMKGINYNSSVAKSAQECQERCTDDVHCHFFTYATRQFPSLEHR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites