GlyCosmos Portal

Submissions

Protein unc-93 homolog B1

Summary

UniProt ID: E9PYK0
Gene Symbol: Unc93b Unc93b1
Gene ID: 54445
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0002420
Re-Glyco: E9PYK0

Annotation

Keyword: Adaptive immunity Antiviral defense Cytoplasmic vesicle Endoplasmic reticulum Endosome Glycoprotein Innate immunity Lysosome Phosphoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
toll-like receptor signaling pathway	IEA	GO_REF
adaptive immune response
toll-like receptor 3 signaling pathway	IEA	GO_REF GO_REF
toll-like receptor 7 signaling pathway	IEA	GO_REF GO_REF
toll-like receptor 9 signaling pathway	IEA	GO_REF GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response [inference]

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to virus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

immune response [inference]

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

toll-like receptor signaling pathway

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

endolysosomal toll-like receptor signaling pathway [inference]

Displaying **all 4** entries
GO Term	Evidence Code	Reference
lysosome	IEA	GO_REF
endosome	IEA	GO_REF GO_REF GO_REF
endoplasmic reticulum membrane	IEA	GO_REF
phagocytic vesicle	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

endocytic vesicle [inference]

phagocytic vesicle

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

endocytic vesicle [inference]

phagocytic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

endocytic vesicle [inference]

phagocytic vesicle

Displaying 1 entry
GO Term	Evidence Code	Reference
Toll-like receptor binding	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

Toll-like receptor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKEVPTSCWCPELQALDLDLVMEVEPPLYPVAGAAGPQGDEDRHGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGVVKNVLAASTGVTLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPIAALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMGNYITRMSQKYYEYSHYKEQDEQGPQQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMIYFLNNYLYDLNHTLINVQSCGTKSQGILNGFNKTVLRTLPRSKNLIVVESVLMAVAFLAMLMVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDFRLRHLVPFFIYSGFEVLFACTGFALGYGVCSMGLERLAYLLIAYSLGASASSVLGLLGLWLPRSVPLVAGAGLHLLLTLSLFFWAPAPRVLQHSWIFYFVAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAVAIFVVYLGSSLPMKAKLAVLLVTLVAAAASYLWMEQKLQQGLVPRQPRIPKPQHKVRGYRYLEEDNSDESDMEGEQGQGDCAEDEAPQAGPLGAEPAGPCRKPCPYEQALGGDGPEEQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
293				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements