GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Alkaline phosphatase

Summary

UniProt ID: F8VPQ6
Gene Symbol: Alpi
Gene ID: 76768
Organism: Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0002795
Re-Glyco: F8VPQ6

Annotation

Keyword: Calcium Cell membrane GPI-anchor Hydrolase Magnesium Metal-binding Proteomics identification Reference proteome Signal Zinc

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
coenzyme A catabolic process	ISO	PMID
cellular response to BMP stimulus	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

sulfur compound metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

sulfur compound catabolic process [inference]

coenzyme A catabolic process

phosphorus metabolic process [inference]

phosphate-containing compound metabolic process [inference]

nucleoside phosphate metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

organophosphate metabolic process [inference]

nucleoside phosphate metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

catabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

sulfur compound catabolic process [inference]

coenzyme A catabolic process

organophosphate catabolic process [inference]

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

purine-containing compound catabolic process [inference]

coenzyme A catabolic process

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleobase-containing compound catabolic process [inference]

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

small molecule metabolic process [inference]

nucleobase-containing small molecule metabolic process [inference]

nucleoside phosphate metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

nucleoside phosphate catabolic process [inference]

coenzyme A catabolic process

purine-containing compound metabolic process [inference]

coenzyme A metabolic process [inference]

coenzyme A catabolic process

purine-containing compound catabolic process [inference]

coenzyme A catabolic process

response to stimulus [inference]

response to endogenous stimulus [inference]

response to growth factor [inference]

cellular response to growth factor stimulus [inference]

cellular response to BMP stimulus

response to BMP [inference]

cellular response to BMP stimulus

cellular response to endogenous stimulus [inference]

cellular response to growth factor stimulus [inference]

cellular response to BMP stimulus

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
obsolete extracellular space
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF
external side of plasma membrane	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

side of membrane [inference]

external side of plasma membrane

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
magnesium ion binding	ISO	GO_REF
protease binding	ISO	GO_REF
alkaline phosphatase activity	ISO	GO_REF GO_REF
alkaline phosphatase activity	IBA	GO_REF
alkaline phosphatase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

phosphoric ester hydrolase activity [inference]

phosphatase activity

alkaline phosphatase activity

binding [inference]

protein binding [inference]

enzyme binding [inference]

protease binding

identical protein binding [inference]

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

magnesium ion binding

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQGDWVLLLFLGLRIHLSFGIIPAEEENPAFWNKKAAEALDAAKKLQPIQTSAKNLIIFLGDGMGVPTVTATRILKGQLEGHLGPETPLAMDLFPYMALSKTYNVDRQVPDSAGTATAYLCGVKANYKTIGLSAAARLDQCNTTFGNEVFSVMYRAKKAGKSVGVVTTTRVQHASPAGTYAHTVNRNWYSDAEMPASALQDGCKDIATQLISNMDIDVILGGGRKFMFPKGTPDPEYPSDSNQSGTRLDDQNLVQTWLSKHQGARYVWNRSELIQASQDPAVTHLMGLFEPTEMKYDANRNPSVDPSLAEMTEVAVRMLSRNPQGFYLFVEGGRIDQGHHAGTAYLALTEAVMFDSAIEKASQLTNEKDTLILITADHSHVFAFGGYTLRGTSIFGLAPLKALDDKSYTSILYGNGPGYELKSGNRPNVTEAQSVDPNYKQQAAVPLSSETHGGEDVAIFARGPQAHLVHGVQEQNYIAHVMAFAGCLEPYTDCGLAPPAGQSPVITPGQATTTNNAAGQATTTNNAAGQATVLLSLQLLVSMLLLVGTAMVVS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
428				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Digestion	Mus musculus
Intra-Golgi traffic	Mus musculus
Post-translational modification: synthesis of GPI-anchored proteins	Mus musculus
Synthesis of PA	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026