GlyCosmos Portal

Submissions

12-(S)-hydroxy-5,8,10,14-eicosatetraenoic acid receptor

Summary

UniProt ID: F8VQN3
Gene Symbol: Gpr31 Gpr31b Gpr31c
Gene ID: 436440
Organism: Mus musculus (house mouse)

External Links

PubChem: F8VQN3
Re-Glyco: F8VQN3

Annotation

Keyword: Cell membrane G-protein coupled receptor Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
response to molecule of bacterial origin	IDA	PMID
response to ischemia	IMP	PMID
G protein-coupled receptor signaling pathway	ISS	GO_REF
G protein-coupled receptor signaling pathway	ISO	GO_REF
G protein-coupled receptor signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

response to stimulus [inference]

response to stress [inference]

response to ischemia

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to molecule of bacterial origin

response to abiotic stimulus [inference]

response to pH [inference]

response to acidic pH

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response

regulation of immune response [inference]

positive regulation of immune response

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune response

positive regulation of response to stimulus [inference]

positive regulation of immune response

negative regulation of biological process [inference]

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

positive regulation of response to stimulus [inference]

positive regulation of immune response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of immune response [inference]

positive regulation of immune response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor activity	ISS	GO_REF
G protein-coupled receptor activity	ISO	GO_REF
G protein-coupled receptor activity	IEA	GO_REF GO_REF
bioactive lipid receptor activity	IMP	PMID
bioactive lipid receptor activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

fatty acid binding [inference]

long-chain fatty acid binding [inference]

icosatetraenoic acid binding [inference]

arachidonate binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding [inference]

long-chain fatty acid binding [inference]

icosatetraenoic acid binding [inference]

arachidonate binding

icosanoid binding [inference]

arachidonate binding

organic acid binding [inference]

carboxylic acid binding [inference]

monocarboxylic acid binding [inference]

fatty acid binding [inference]

long-chain fatty acid binding [inference]

icosatetraenoic acid binding [inference]

arachidonate binding

icosanoid binding [inference]

arachidonate binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

bioactive lipid receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MERTNCSAASTVVETAVGTMLTLECVLGLMGNAVALWTFFYRLKVWKPYAVYLFNLVVADLLLATSLPFFAAFYLKGKTWKLGHMPCQVLLFLLAFSRGVGVAFLTTVALDRYLRVVHPRLRVNLLSLRAAWGISSLIWLLMVVLTPQNLLTCRTTQNSTECPSFYPTGGAKAIATCQEVLFFLQVLLPFGLISFCNSGLIRTLQKRLRESDKQPRIRRARVLVAIVLLLFGLCFLPSVLTRVLVHIFQEFKSCSVQQAIVRASDIAGSLTCLHSTLSPAIYCFSNPAFTHSYRKVLKSLRGRRKAAESPSDNLRDSYS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
5	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Free fatty acid receptors	Mus musculus
G alpha (i) signalling events	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements