GlyCosmos Portal

Submissions

Phosphoinositide phospholipase C

Summary

UniProt ID: G1NG12
Gene Symbol: PLCD4
Gene ID
Organism: Meleagris gallopavo (turkey)

External Links

Re-Glyco: G1NG12

Annotation

Keyword: Calcium Cytoplasm Endoplasmic reticulum Glycoprotein Hydrolase Lipid degradation Membrane Metal-binding Nucleus Reference proteome Repeat Transducer

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
lipid catabolic process	IEA	GO_REF
intracellular signal transduction	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

intracellular signal transduction

metabolic process [inference]

catabolic process [inference]

lipid catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

lipid catabolic process

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

intracellular signal transduction

Displaying **all 3** entries
GO Term	Evidence Code	Reference
nucleus	IEA	GO_REF
endoplasmic reticulum	IEA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Displaying **all 3** entries
GO Term	Evidence Code	Reference
phosphatidylinositol-4,5-bisphosphate phospholipase C activity	IEA	GO_REF GO_REF GO_REF GO_REF
calcium ion binding	IEA	GO_REF GO_REF
phosphatidylinositol phospholipase C activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

lipase activity [inference]

phospholipase activity [inference]

glycerophospholipase activity [inference]

C-type glycerophospholipase activity [inference]

phosphoric ester hydrolase activity [inference]

phosphoric diester hydrolase activity [inference]

C-type glycerophospholipase activity [inference]

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MGAYLGGHGEHQRAAHELRVLVLGCGGVQGDAHLPGLGPAGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPVRSQSEEHGRYGAERSGTGELQCQHGGGRAMASLLCNARIQLTETLEKMQQGTLMRKVKSKSWKKQRYFKLQDDCMTIWYQSKRTGKIESAFSISDVETVREGHQSEVLQSLAEEFPPERCFTIVFYGRRGNLDLIAGTEEEAQCWVQGLRQLIEVATSMDQRERIDQWIRDWFQKADKNKDGRMNFKEVQRLLKMMNVDMNEDHALRLFQAADKSESGTLEGEEFVLFYKALTERKEVQSLFQEFSEDGKKLTLLELVDFLRQEQLEEEGTEELAMELIDKYEPSETARARHALSADGFLMYLCSPEGSIFNSQHRALWQDMTQPLCHYFISSSHNTYLIEDQIRGQSSIEGYIRALKRGCRCLEVDCWDGPNGEPIVYHGHTFTSKIPFREVVSTLGKYAFQASDFPVILSLENHCSMEQQEVLAQQLKDILGEHLLTTTTDGRVPTQLPSPEELKHKILLKGKKIGRLEDTLDGPGDEAPDVSDDDNGAEAEEEKRRMKKDRESLAQALSDCVVYCKNVSFRGFQEARNHSRPSEISSLSEAKARKLIRDAGNEFVRHNTWQLTRIYPSGMRTDSSNYSPQEMWNAGCQIVALNFQTAGMEMDLCDGLFSQNGHCGYVLKPSFMRDEGTLFNPSDPSTWQGPGPVTLTIQVISGQQLPKVANSKDGAIIDPLVRVEIHGVPADQAHQETKYIENNGFNPHWDETLQFQLQVPQLALVRFVVEDYDKTSRNDFVGQFTLAFANIKPGYRHIHLLSKDGTSIPPSSLFVHIRITEPPGPEQD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites