GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Chitin deacetylase 8

Summary

UniProt ID: H9JW43
Gene Symbol: CDA8
Gene ID: 101735686
Organism: Bombyx mori (domestic silkworm)

External Links

Re-Glyco: H9JW43

Annotation

Keyword: 3D-structure Chitin degradation Disulfide bond Glycoprotein Hydrolase Metal-binding Reference proteome Secreted Signal Zinc

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
polysaccharide catabolic process	IDA	PMID
chitin catabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

polysaccharide catabolic process

aminoglycan catabolic process [inference]

chitin catabolic process

carbohydrate catabolic process [inference]

polysaccharide catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

macromolecule metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

chitin metabolic process [inference]

chitin catabolic process

macromolecule catabolic process [inference]

polysaccharide catabolic process

aminoglycan catabolic process [inference]

chitin catabolic process

primary metabolic process [inference]

carbohydrate metabolic process [inference]

polysaccharide metabolic process [inference]

polysaccharide catabolic process

carbohydrate catabolic process [inference]

polysaccharide catabolic process

carbohydrate derivative metabolic process [inference]

aminoglycan metabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

chitin metabolic process [inference]

chitin catabolic process

amino sugar metabolic process [inference]

chitin metabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

carbohydrate derivative catabolic process [inference]

aminoglycan catabolic process [inference]

chitin catabolic process

amino sugar catabolic process [inference]

glucosamine-containing compound catabolic process [inference]

chitin catabolic process

Displaying 1 entry
GO Term	Evidence Code	Reference
obsolete extracellular space

GO Hierarchy

cellular component

Displaying **all 3** entries
GO Term	Evidence Code	Reference
chitin deacetylase activity	IDA	PMID
chitin deacetylase activity	IEA	GO_REF GO_REF
zinc ion binding	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds [inference]

hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in linear amides [inference]

chitin deacetylase activity

deacylase activity [inference]

deacetylase activity [inference]

chitin deacetylase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKRLSVLCSLLLVAAALGTELPLATPCDEEACKLPDCRCSSTNIPGGLRARDTPQFVTVTFDDGINVINIETYREVLYGRSNSNRCPAGATFYVSHEYTNYQLVNELYNRGFEIALHSISHRTPQAFWADATYQNLVQEIGDQKRQMAHFASIPASAIKGVRIPFLQMSGNTSFQVMADFDLLYDCTWPTTALTNPGLWPYTLHHESIQDCIIPPCPTASIPGPWVLPMISWRDLNNFPCSMVDGCFFTPDRTDEEGWFKFILTNFERHYLGNRAPFGFFVHEWFISSNPAIKRAFVRFMDIINNLNDVFMVNSAEVIDWVKNPVPIDRYRQQQCKFTMPSICRPSFCGPLTGTHNQLSYYMTICNTCPRNYPWVGNPLGQ

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
171	N-linked (GlcNAc...) asparagine	30755482		UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026