GlyCosmos Portal

Submissions

Reticulocalbin-3

Summary

UniProt ID: I6L9G5
Gene Symbol: Rcn3
Gene ID: 494125
Organism: Rattus norvegicus (Norway rat)

External Links

Re-Glyco: I6L9G5

Annotation

Keyword: Calcium Chaperone Direct protein sequencing Endoplasmic reticulum Glycoprotein Metal-binding Reference proteome Repeat Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 25 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
protein secretion	ISS	GO_REF
protein secretion	ISO	GO_REF
protein secretion	IEA	GO_REF
positive regulation of peptidase activity	ISS	GO_REF
positive regulation of peptidase activity	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

biosynthetic process [inference]

collagen biosynthetic process

collagen metabolic process [inference]

collagen biosynthetic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

primary metabolic process [inference]

protein metabolic process [inference]

protein catabolic process [inference]

proteasomal protein catabolic process [inference]

ERAD pathway

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

export from cell [inference]

secretion by cell [inference]

protein secretion

multicellular organismal process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

developmental process [inference]

anatomical structure development [inference]

tissue development [inference]

epithelium development [inference]

lung epithelium development

homeostatic process [inference]

multicellular organismal-level homeostasis [inference]

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

chemical homeostasis [inference]

lipid homeostasis [inference]

phospholipid homeostasis

multicellular organismal-level chemical homeostasis [inference]

surfactant homeostasis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

response to chemical [inference]

ERAD pathway

cellular response to stimulus [inference]

cellular response to stress [inference]

response to endoplasmic reticulum stress [inference]

ERAD pathway

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

protein secretion

protein localization to extracellular region [inference]

protein secretion

establishment of localization [inference]

transport [inference]

protein transport

protein secretion

secretion [inference]

secretion by cell [inference]

protein secretion

export from cell [inference]

secretion by cell [inference]

protein secretion

establishment of protein localization [inference]

protein transport

protein secretion

establishment of protein localization to extracellular region [inference]

protein secretion

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of metabolic process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of peptidase activity [inference]

positive regulation of peptidase activity

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of proteolysis [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of peptidase activity [inference]

positive regulation of peptidase activity

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of proteolysis [inference]

positive regulation of peptidase activity

regulation of molecular function [inference]

positive regulation of molecular function [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of peptidase activity

regulation of catalytic activity [inference]

positive regulation of catalytic activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of peptidase activity

regulation of hydrolase activity [inference]

positive regulation of hydrolase activity [inference]

positive regulation of peptidase activity

regulation of peptidase activity [inference]

positive regulation of peptidase activity

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum	ISS	GO_REF
endoplasmic reticulum	ISO	GO_REF
endoplasmic reticulum	IBA	GO_REF
endoplasmic reticulum	IEA	GO_REF GO_REF
endoplasmic reticulum lumen	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

endoplasmic reticulum lumen

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying **all 4** entries
GO Term	Evidence Code	Reference
calcium ion binding	ISS	GO_REF
calcium ion binding	ISO	GO_REF
calcium ion binding	IBA	GO_REF
calcium ion binding	IEA	GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MMWRWTLMLLLLLLRHWALGKPSPDAGPHGQDRVHHGTPLSEAPHDDAHGNFQYDHEAFLGRDVAKEFDQLTPEESQARLGRIVDRMDLAGDSDGWVSLAELRAWIAHTQQRHIRDSVSAAWHTYDTDRDGRVGWEELRNATYGHYEPGEEFHDVEDAETYKKMLARDERRFRVADQDGDSMATREELTAFLHPEEFPHMRDIVVAETLEDLDKNKDGYVQVEEYIADLYSAEPGEEEPAWVQTERQQFRDFRDLNKDGRLDGSEVGYWVLPPSQDQPLVEANHLLHESDTDKDGRLSKAEILSNWNMFVGSQATNYGEDLTRHHDEL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites