GlyCosmos Portal

Submissions

Tumor necrosis factor receptor superfamily member 11B

Summary

UniProt ID: O00300
Gene Symbol: OCIF OPG TNFRSF11B
Gene ID: 4982
Organism: Homo sapiens (human)

External Links

GlycoProtDB

GPDB0011151

GlyConnect

Tumor necrosis factor receptor superfamily member 11B

GlyGen

O00300

PubChem

O00300

The Human Metabolome Database

HMDBP02763

The O-GlcNAc Database

O00300

Re-Glyco

O00300

Annotation

Keyword: 3D-structure Apoptosis Direct protein sequencing Disease variant Disulfide bond Glycoprotein Proteomics identification Receptor Reference proteome Repeat Secreted Signal

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
skeletal system development	TAS	PMID
apoptotic process
signal transduction	TAS	PMID
signal transduction	IEA	GO_REF
negative regulation of tumor necrosis factor-mediated signaling pathway

GO Hierarchy

biological process

cellular process [inference]

signal transduction

cell death [inference]

programmed cell death [inference]

apoptotic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

extracellular structure organization [inference]

extracellular matrix organization

external encapsulating structure organization [inference]

extracellular matrix organization

developmental process [inference]

anatomical structure development [inference]

system development [inference]

skeletal system development

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of response to cytokine stimulus [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of animal organ morphogenesis [inference]

regulation of odontogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of odontogenesis of dentin-containing tooth [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cellular process [inference]

signal transduction

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of tumor necrosis factor-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of cellular process [inference]

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of cytokine-mediated signaling pathway [inference]

negative regulation of tumor necrosis factor-mediated signaling pathway

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of animal organ morphogenesis [inference]

negative regulation of odontogenesis [inference]

negative regulation of odontogenesis of dentin-containing tooth

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	NAS	PMID
extracellular region	TAS	PMID
extracellular region	IDA	PMID
extracellular region	IEA	GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

cellular anatomical structure [inference]

extracellular region

membrane [inference]

plasma membrane

external encapsulating structure [inference]

extracellular matrix

Displaying **all 3** entries
GO Term	Evidence Code	Reference
cytokine activity	TAS	PMID
signaling receptor activity	TAS	PMID
heparan sulfate binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

organic acid binding [inference]

carboxylic acid binding [inference]

heparan sulfate binding

carbohydrate derivative binding [inference]

glycosaminoglycan binding [inference]

heparan sulfate binding

sulfur compound binding [inference]

heparan sulfate binding

molecular transducer activity [inference]

signaling receptor activity

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNNLLCCALVFLDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTVCAPCPDHYYTDSWHTSDECLYCSPVCKELQYVKQECNRTHNRVCECKEGRYLEIEFCLKHRSCPPGFGVVQAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSVFGLLLTQKGNATHDNICSGNSESTQKCGIDVTLCEEAFFRFAVPTKFTPNWLSVLVDNLPGTKVNAESVERIKRQHSSQEQTFQLLKLWKHQNKDQDIVKKIIQDIDLCENSVQRHIGHANLTFEQLRSLMESLPGKKVGAEDIEKTIKACKPSDQILKLLSLWRIKNGDQDTLKGLMHALKHSKTYHFPKTVTQSLKKTIRFLHSFTMYKLYQKLFLEMIGNQVQSVKISCL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 7** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
98	N-linked (GlcNAc...) asparagine			UniProt GlyGen
151		38665916 40930100	G49108TO	The O-GlcNAc Database
152	N-linked (GlcNAc...) asparagine	23090970 24190977 32125861 37074911	G06356OH G37868ZX G80920RR G62765YT G22140GZ G50045TK G31852PQ G33609NS G41247ZX G02815KT	GlycoProtDB UniProt GlyGen GlyConnect
165	N-linked (GlcNAc...) asparagine	23090970 24190977		UniProt GlyGen
178	N-linked (GlcNAc...) asparagine	22664871 23090970 24190977 37074911	G15664MX G31852PQ	UniProt GlyGen
183		16491292 23090970 24190977		GlyGen
289	N-linked (GlcNAc...) asparagine	32125861	G86795LJ G90093AU G96577RX G81263BG G08146BT G22310AV G66163OV G71146HJ G75983OB G45495MK G84452RH G42962KI G44215PV G23863VK G57818FI G46687AB G61937QU G29880MM	GlycoProtDB UniProt GlyGen GlyConnect

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
TNFs bind their physiological receptors	Homo sapiens

Disease

Displaying **all 3** entries
DO ID	Disease Name	Source
DOID:8398	osteoarthritis	Alliance of Genome Resources
DOID:5408	Paget's disease of bone	Alliance of Genome Resources
DOID:0081368	Paget's disease of bone 5	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements