GlyCosmos Portal

Submissions

Putative P2Y purinoceptor 10

Summary

UniProt ID: O00398
Gene Symbol: P2RY10
Gene ID: 27334
Organism: Homo sapiens (human)

External Links

GlyGen: O00398
PubChem: O00398
Re-Glyco: O00398

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Proteomics identification Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying **all 2** entries
GO Term	Evidence Code	Reference
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

Displaying **all 3** entries
GO Term	Evidence Code	Reference
plasma membrane	TAS	Reactome Reactome Reactome Reactome
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
G protein-coupled receptor activity	IBA	GO_REF
G protein-coupled receptor activity	IEA	GO_REF

GO Hierarchy

molecular function

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MANLDKYTETFKMGSNSTSTAEIYCNVTNVKFQYSLYATTYILIFIPGLLANSAALWVLCRFISKKNKAIIFMINLSVADLAHVLSLPLRIYYYISHHWPFQRALCLLCFYLKYLNMYASICFLTCISLQRCFFLLKPFRARDWKRRYDVGISAAIWIVVGTACLPFPILRSTDLNNNKSCFADLGYKQMNAVALVGMITVAELAGFVIPVIIIAWCTWKTTISLRQPPMAFQGISERQKALRMVFMCAAVFFICFTPYHINFIFYTMVKETIISSCPVVRIALYFHPFCLCLASLCCLLDPILYYFMASEFRDQLSRHGSSVTRSRLMSKESGSSMIG

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	GlyTouCan ID	Source
16	N-linked (GlcNAc...) asparagine		UniProt GlyGen
26	N-linked (GlcNAc...) asparagine		UniProt GlyGen
75		G69704ZP	GlyGen
178	N-linked (GlcNAc...) asparagine		UniProt GlyGen