GlyCosmos Portal

Submissions

Tumor necrosis factor ligand superfamily member 4

Summary

UniProt ID

O02765

Gene Symbol

TNFSF4
TXGP1

Gene ID

[100008595]

Organism

Oryctolagus cuniculus (rabbit)

External Links

PubChem: O02765
Re-Glyco: O02765

Annotation

Keyword: Cytokine Disulfide bond Glycoprotein Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
positive regulation of cytokine production	IEA	GO_REF
inflammatory response	IEA	GO_REF
immune response	IEA	GO_REF
positive regulation of T cell proliferation	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

immune response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

regulation of cell adhesion [inference]

regulation of cell-cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation [inference]

positive regulation of leukocyte proliferation [inference]

positive regulation of mononuclear cell proliferation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of cytokine production

positive regulation of cell adhesion [inference]

positive regulation of cell-cell adhesion [inference]

positive regulation of leukocyte cell-cell adhesion [inference]

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

positive regulation of cytokine production

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

positive regulation of multicellular organismal process [inference]

positive regulation of cytokine production

positive regulation of cell activation [inference]

positive regulation of leukocyte activation [inference]

positive regulation of lymphocyte activation [inference]

positive regulation of lymphocyte proliferation [inference]

positive regulation of T cell proliferation

positive regulation of T cell activation [inference]

positive regulation of T cell proliferation

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
cytokine activity	IEA	GO_REF
tumor necrosis factor receptor binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

tumor necrosis factor receptor superfamily binding [inference]

tumor necrosis factor receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity [inference]

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEGVRPLEENVGNAPRPRFERNKLLLVASVVQALGLLLCLTYVCQHSHAPEVSLQYPPIENIMTQLQILTSHECEEDSFILPLQKRDGTMEVQNNSVVIQCDGFYLLSLKGYFSQEVSISLHYRKGEEPFPILKKTKFANSNVVLKLGYKDKVYLNVTTDSASCKQLSVNAGELIVILQNPGGYCAP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
94	N-linked (GlcNAc...) asparagine			UniProt
156	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements