GlyCosmos Portal

Submissions

Sphingosine 1-phosphate receptor 1

Summary

UniProt ID: O08530
Gene Symbol: Edg1 Lpb1 S1pr1
Gene ID: 13609
Organism: Mus musculus (house mouse)

External Links

PubChem: O08530
Re-Glyco: O08530

Annotation

Keyword: Acetylation Angiogenesis Cell membrane Chemotaxis Disulfide bond Endosome G-protein coupled receptor Glycoprotein Palmitate Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 44 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
angiogenesis	IDA	PMID
angiogenesis	IBA	GO_REF
blood vessel maturation	IMP	PMID
cardiac muscle tissue growth involved in heart morphogenesis	IMP	PMID
sphingosine-1-phosphate receptor signaling pathway	ISS	GO_REF

GO Hierarchy

biological process

immune system process [inference]

leukocyte migration [inference]

leukocyte chemotaxis

mononuclear cell migration [inference]

lymphocyte migration [inference]

T cell migration

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

sphingosine-1-phosphate receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

phospholipase C-activating G protein-coupled receptor signaling pathway

sphingolipid mediated signaling pathway [inference]

sphingosine-1-phosphate receptor signaling pathway

actin filament-based process [inference]

actin cytoskeleton organization

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation

cell motility [inference]

cell migration

leukocyte migration [inference]

leukocyte chemotaxis

mononuclear cell migration [inference]

lymphocyte migration [inference]

T cell migration

cell chemotaxis [inference]

leukocyte chemotaxis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

actin cytoskeleton organization

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

cell projection organization [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

plasma membrane bounded cell projection organization [inference]

lamellipodium organization [inference]

lamellipodium assembly

plasma membrane bounded cell projection assembly [inference]

lamellipodium assembly

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

transmission of nerve impulse

developmental process [inference]

anatomical structure morphogenesis [inference]

trabecula morphogenesis [inference]

heart trabecula morphogenesis

developmental maturation [inference]

anatomical structure maturation [inference]

blood vessel maturation

anatomical structure formation involved in morphogenesis [inference]

angiogenesis

anatomical structure development [inference]

animal organ development [inference]

brain development

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

epithelial cell differentiation [inference]

endothelial cell differentiation

growth [inference]

developmental growth [inference]

cardiac muscle tissue growth [inference]

cardiac muscle tissue growth involved in heart morphogenesis

developmental growth involved in morphogenesis [inference]

growth involved in heart morphogenesis [inference]

cardiac muscle tissue growth involved in heart morphogenesis

locomotion [inference]

taxis [inference]

chemotaxis

cell chemotaxis [inference]

leukocyte chemotaxis

biological regulation [inference]

regulation of biological process [inference]

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of biological process [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell motility [inference]

positive regulation of cell migration

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

regulation of chemotaxis [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

regulation of positive chemotaxis [inference]

positive regulation of positive chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of positive chemotaxis

regulation of developmental process [inference]

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

sphingosine-1-phosphate receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

phospholipase C-activating G protein-coupled receptor signaling pathway

sphingolipid mediated signaling pathway [inference]

sphingosine-1-phosphate receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

regulation of RNA metabolic process [inference]

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

regulation of cell adhesion

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

regulation of smooth muscle cell proliferation [inference]

positive regulation of smooth muscle cell proliferation

regulation of cellular component biogenesis [inference]

regulation of actin filament bundle assembly [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of smooth muscle cell proliferation

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of RNA metabolic process [inference]

positive regulation of RNA biosynthetic process [inference]

positive regulation of DNA-templated transcription [inference]

positive regulation of transcription by RNA polymerase II

positive regulation of cell motility [inference]

positive regulation of cell migration

negative regulation of cellular process [inference]

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of cytoskeleton organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

negative regulation of stress fiber assembly

negative regulation of supramolecular fiber organization [inference]

negative regulation of actin filament bundle assembly [inference]

negative regulation of stress fiber assembly

regulation of cell motility [inference]

regulation of cell migration [inference]

positive regulation of cell migration

positive regulation of cell motility [inference]

positive regulation of cell migration

regulation of multicellular organismal process [inference]

regulation of ossification [inference]

regulation of bone mineralization

regulation of tissue remodeling [inference]

regulation of bone remodeling [inference]

regulation of bone resorption

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of bone mineralization

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
nucleoplasm	ISO	GO_REF
cytoplasm	IBA	GO_REF
endosome	ISS	GO_REF
endosome	IEA	GO_REF
plasma membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

membrane microdomain [inference]

membrane raft

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

side of membrane [inference]

external side of plasma membrane

presynapse

Displaying entries **1 - 5** of 11 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled receptor binding	ISO	GO_REF
G protein-coupled receptor binding	IEA	GO_REF
G protein-coupled receptor activity	ISO	GO_REF
G protein-coupled receptor activity	IEA	GO_REF GO_REF
sphingosine-1-phosphate receptor activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

G protein-coupled receptor binding

lipid binding [inference]

sphingolipid binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity

bioactive lipid receptor activity [inference]

sphingosine-1-phosphate receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVSTSIPEVKALRSSVSDYGNYDIIVRHYNYTGKLNIGAEKDHGIKLTSVVFILICCFIILENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLREGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNSSRSFLLISACWVISLILGGLPIMGWNCISSLSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKAKTCDILYKAEYFLVLAVLNSGTNPIIYTLTNKEMRRAFIRIVSCCKCPNGDSAGKFKRPIIPGMEFSRSKSDNSSHPQKDDGDNPETIMSSGNVNSSS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
30	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Lysosphingolipid and LPA receptors	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements