GlyCosmos Portal

Submissions

Vesicle-trafficking protein SEC22b

Summary

UniProt ID

O08547

Gene Symbol

Sec22b
Sec22l1

Gene ID

[20333]

Organism

Mus musculus (house mouse)

External Links

GlyGen: O08547
PubChem: O08547
RaftProt: O08547
Re-Glyco: O08547

Annotation

Keyword: 3D-structure Acetylation Coiled coil Direct protein sequencing ER-Golgi transport Endoplasmic reticulum Golgi apparatus Phosphoprotein Protein transport Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	PMID
endoplasmic reticulum to Golgi vesicle-mediated transport	IEA	GO_REF
retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IBA	GO_REF
retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	IEA	GO_REF
protein transport

GO Hierarchy

biological process

cellular process [inference]

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

vesicle-mediated transport

Golgi vesicle transport [inference]

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

Golgi organization [inference]

vesicle fusion with Golgi apparatus

vesicle organization [inference]

vesicle fusion [inference]

vesicle fusion with Golgi apparatus

organelle fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

vesicle fusion with Golgi apparatus

membrane organization [inference]

membrane fusion [inference]

organelle membrane fusion [inference]

vesicle fusion [inference]

vesicle fusion with Golgi apparatus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

protein transport

vesicle-mediated transport

Golgi vesicle transport [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

establishment of protein localization [inference]

protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

cellular localization [inference]

intracellular transport [inference]

endoplasmic reticulum to Golgi vesicle-mediated transport

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

regulation of cellular process [inference]

regulation of metabolic process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of catabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

regulation of autophagy [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

regulation of macroautophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of cellular component biogenesis [inference]

regulation of organelle assembly [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

regulation of autophagosome assembly [inference]

negative regulation of autophagosome assembly

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of catabolic process [inference]

negative regulation of autophagy [inference]

negative regulation of macroautophagy [inference]

negative regulation of autophagosome assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

regulation of vacuole organization [inference]

regulation of autophagosome assembly [inference]

negative regulation of autophagosome assembly

regulation of organelle assembly [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

regulation of autophagosome assembly [inference]

negative regulation of autophagosome assembly

negative regulation of cellular component organization [inference]

negative regulation of organelle organization [inference]

negative regulation of organelle assembly [inference]

negative regulation of autophagosome assembly

Displaying entries **1 - 5** of 24 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	IDA	PMID PMID
Golgi membrane	IBA	GO_REF
endoplasmic reticulum membrane	ISS	GO_REF
endoplasmic reticulum membrane	ISO	GO_REF
endoplasmic reticulum membrane	IDA	PMID

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

SNARE complex

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

transport vesicle membrane [inference]

ER to Golgi transport vesicle membrane

coated vesicle membrane [inference]

ER to Golgi transport vesicle membrane

bounding membrane of organelle [inference]

Golgi membrane

transport vesicle membrane [inference]

ER to Golgi transport vesicle membrane

coated vesicle membrane [inference]

ER to Golgi transport vesicle membrane

endoplasmic reticulum-Golgi intermediate compartment membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

Golgi-associated vesicle [inference]

COPI-coated vesicle

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

COPI-coated vesicle

pigment granule [inference]

melanosome

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum-Golgi intermediate compartment

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

Golgi-associated vesicle [inference]

COPI-coated vesicle

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

COPI-coated vesicle

pigment granule [inference]

melanosome

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum-Golgi intermediate compartment

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

Golgi-associated vesicle [inference]

COPI-coated vesicle

transport vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

coated vesicle [inference]

COPI-coated vesicle

pigment granule [inference]

melanosome

secretory vesicle [inference]

exocytic vesicle [inference]

synaptic vesicle

Displaying **all 3** entries
GO Term	Evidence Code	Reference
SNAP receptor activity	IBA	GO_REF
SNAP receptor activity	IEA	GO_REF
syntaxin binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

SNARE binding [inference]

syntaxin binding

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

SNAP receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVLLTMIARVADGLPLAASMQEDEQSGRDLQQYQSQAKQLFRKLNEQSPTRCTLEAGAMTFHYIIEQGVCYLVLCEAAFPKKLAFAYLEDLHSEFDEQHGKKVPTVSRPYSFIEFDTFIQKTKKLYIDSRARRNLGSINTELQDVQRIMVANIEEVLQRGEALSALDSKANNLSSLSKKYRQDAKYLNMRSTYAKLAAVAVFFIMLIVYVRFWWL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites