GlyCosmos Portal

Submissions

3-hydroxyacyl-CoA dehydrogenase type-2

Summary

UniProt ID: O08756
Gene Symbol: Erab Hadh2 Hsd17b10
Gene ID
Organism: Mus musculus (house mouse)

External Links

GlyGen: O08756
PubChem: O08756
RaftProt: O08756
Re-Glyco: O08756

Annotation

Keyword: Acetylation Direct protein sequencing Fatty acid metabolism Mitochondrion nucleoid NAD Oxidoreductase Reference proteome Steroid metabolism tRNA processing

Gene Ontology (GO)

Displaying entries **1 - 5** of 29 in total

1

2

3

4

5

6

Next ›

Last »
GO Term	Evidence Code	Reference
L-isoleucine catabolic process	ISS	GO_REF
L-isoleucine catabolic process	ISO	PMID GO_REF
L-isoleucine catabolic process	IEA	GO_REF
fatty acid metabolic process	IBA	GO_REF
fatty acid beta-oxidation	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

amino acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

mitochondrial gene expression [inference]

mitochondrial RNA processing [inference]

mitochondrial RNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

mitochondrial RNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

methylation [inference]

macromolecule methylation [inference]

RNA methylation [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

ketone metabolic process [inference]

brexanolone metabolic process

hormone metabolic process [inference]

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression [inference]

mitochondrial gene expression [inference]

mitochondrial RNA processing [inference]

mitochondrial RNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

mitochondrial RNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

macromolecule modification [inference]

RNA modification [inference]

RNA methylation [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

mitochondrial RNA modification [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

macromolecule methylation [inference]

RNA methylation [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mitochondrial RNA metabolic process [inference]

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

mitochondrial RNA modification [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA metabolic process [inference]

tRNA processing [inference]

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

RNA modification [inference]

RNA methylation [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

mitochondrial RNA modification [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

primary metabolic process [inference]

nucleobase-containing compound metabolic process [inference]

nucleic acid metabolic process [inference]

RNA metabolic process [inference]

mitochondrial RNA metabolic process [inference]

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

mitochondrial RNA modification [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA metabolic process [inference]

tRNA processing [inference]

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

RNA modification [inference]

RNA methylation [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

mitochondrial RNA modification [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

RNA processing [inference]

mitochondrial RNA processing [inference]

mitochondrial RNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

mitochondrial RNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

RNA 5'-end processing [inference]

mitochondrial RNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

tRNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

tRNA processing [inference]

tRNA modification [inference]

tRNA methylation [inference]

mitochondrial tRNA methylation

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

mitochondrial tRNA processing [inference]

mitochondrial tRNA modification [inference]

mitochondrial tRNA methylation

tRNA 5'-end processing [inference]

mitochondrial tRNA 5'-end processing

RNA 3'-end processing [inference]

mitochondrial RNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

tRNA 3'-end processing [inference]

mitochondrial tRNA 3'-end processing

amino acid metabolic process [inference]

amino acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

branched-chain amino acid metabolic process [inference]

isoleucine metabolic process [inference]

L-isoleucine catabolic process

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

proteinogenic amino acid metabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid metabolic process [inference]

isoleucine metabolic process [inference]

L-isoleucine catabolic process

L-amino acid metabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

lipid metabolic process [inference]

fatty acid metabolic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid oxidation [inference]

fatty acid beta-oxidation

steroid metabolic process [inference]

bile acid metabolic process [inference]

bile acid biosynthetic process

lipid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

lipid modification [inference]

lipid oxidation [inference]

fatty acid oxidation [inference]

fatty acid beta-oxidation

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

branched-chain amino acid metabolic process [inference]

isoleucine metabolic process [inference]

L-isoleucine catabolic process

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

fatty acid catabolic process [inference]

fatty acid beta-oxidation

fatty acid oxidation [inference]

fatty acid beta-oxidation

bile acid metabolic process [inference]

bile acid biosynthetic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

carboxylic acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

proteinogenic amino acid metabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid metabolic process [inference]

isoleucine metabolic process [inference]

L-isoleucine catabolic process

L-amino acid metabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

branched-chain amino acid catabolic process [inference]

L-isoleucine catabolic process

monocarboxylic acid catabolic process [inference]

fatty acid catabolic process [inference]

fatty acid beta-oxidation

proteinogenic amino acid catabolic process [inference]

L-isoleucine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-isoleucine catabolic process

small molecule biosynthetic process [inference]

organic acid biosynthetic process [inference]

carboxylic acid biosynthetic process [inference]

monocarboxylic acid biosynthetic process [inference]

bile acid biosynthetic process

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

cellular component assembly [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

protein homooligomerization [inference]

protein homotetramerization

protein tetramerization [inference]

protein homotetramerization

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

protein complex oligomerization [inference]

protein homooligomerization [inference]

protein homotetramerization

protein tetramerization [inference]

protein homotetramerization

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
mitochondrion	ISS	GO_REF
mitochondrion	ISO	GO_REF
mitochondrion	IDA	PMID PMID
mitochondrion	IBA	GO_REF
mitochondrion	IEA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

mitochondrial protein-containing complex [inference]

mitochondrial ribonuclease P complex

intracellular protein-containing complex [inference]

endonuclease complex [inference]

endoribonuclease complex [inference]

ribonuclease P complex [inference]

mitochondrial ribonuclease P complex

catalytic complex [inference]

endonuclease complex [inference]

endoribonuclease complex [inference]

ribonuclease P complex [inference]

mitochondrial ribonuclease P complex

transferase complex [inference]

methyltransferase complex [inference]

tRNA methyltransferase complex

ribonucleoprotein complex [inference]

ribonuclease P complex [inference]

mitochondrial ribonuclease P complex

cellular anatomical structure [inference]

nucleoid [inference]

mitochondrial nucleoid

membrane [inference]

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

mitochondrial inner membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

mitochondrial nucleoid

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular membraneless organelle [inference]

mitochondrial nucleoid

Displaying entries **1 - 5** of 37 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
tRNA binding	ISS	GO_REF
tRNA binding	ISO	GO_REF
amyloid-beta binding	ISO	GO_REF
(3S)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	ISS	GO_REF
(3S)-3-hydroxyacyl-CoA dehydrogenase (NAD+) activity	ISO	PMID GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

steroid dehydrogenase activity [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

17-beta-hydroxysteroid dehydrogenase (NAD+) activity

testosterone dehydrogenase (NAD+) activity

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

17-beta-hydroxysteroid dehydrogenase (NAD+) activity

testosterone dehydrogenase (NAD+) activity

3-hydroxy-2-methylbutyryl-CoA dehydrogenase activity

binding [inference]

nucleic acid binding [inference]

RNA binding [inference]

tRNA binding

protein binding [inference]

transcription factor binding [inference]

DNA-binding transcription factor binding [inference]

RNA polymerase II-specific DNA-binding transcription factor binding [inference]

nuclear receptor binding [inference]

nuclear estrogen receptor binding

identical protein binding

lipid binding [inference]

steroid binding

small molecule binding [inference]

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding

peptide binding [inference]

amyloid-beta binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

NAD binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAAAVRSVKGLVAVVTGGASGPWLATAKRLVGQGATAVLLDVPDSEGESQAKKLGESCIFAPANVTSEKEIQAALTLAKEKFGRIDVAVNCAGIAVAIKTYHQKKNKIHTLEDFQRVINVNLIGTFNVIRLVAGEMGQNEPDQGGQRGVIINTASVAAFEGQVGQAAYSASKGGIDGMTLPIARDLAPTGIRVVTIAPGLFATPLLTTLPEKVRNFLASQVPFPSRLGDPAEYAHLVQTIIENPFLNGEVIRLDGAIRMQP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites