GlyCosmos Portal

Submissions

Cyclin-dependent kinase inhibitor 1B

Summary

UniProt ID: O08769
Gene Symbol: Cdkn1b p27Kip1
Gene ID: 83571
Organism: Rattus norvegicus (Norway rat)

External Links

GlyGen: O08769
The O-GlcNAc Database: O08769
O-GlcNAcAtlas: O08769
Re-Glyco: O08769

Annotation

Keyword: Cell cycle Cytoplasm Endosome Nucleus Phosphoprotein Protein kinase inhibitor Proteomics identification Reference proteome Ubl conjugation

Gene Ontology (GO)

Displaying entries **1 - 5** of 44 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
G1/S transition of mitotic cell cycle	ISO	GO_REF
G1/S transition of mitotic cell cycle	IBA	GO_REF
response to hypoxia	IEP	PMID
placenta development	ISO	GO_REF
potassium ion transport	ISO	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

cell death [inference]

programmed cell death [inference]

autophagic cell death

intercellular transport [inference]

nuclear export

cell cycle process [inference]

cell cycle phase transition [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

cell cycle G1/S phase transition [inference]

G1/S transition of mitotic cell cycle

mitotic cell cycle process [inference]

mitotic cell cycle phase transition [inference]

G1/S transition of mitotic cell cycle

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to antibiotic

cellular response to metal ion [inference]

cellular response to lithium ion

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of sound

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

inner ear development

response to stimulus [inference]

response to stress [inference]

response to hypoxia

cellular response to hypoxia

cellular response to stress [inference]

cellular response to hypoxia

response to abiotic stimulus [inference]

response to oxygen levels [inference]

response to decreased oxygen levels [inference]

response to hypoxia

cellular response to hypoxia

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to endogenous stimulus [inference]

response to hormone [inference]

response to peptide hormone

response to chemical [inference]

response to acid chemical [inference]

response to amino acid

response to xenobiotic stimulus

response to hormone [inference]

response to peptide hormone

response to metal ion [inference]

response to lithium ion [inference]

cellular response to lithium ion

response to cadmium ion

cellular response to metal ion [inference]

cellular response to lithium ion

response to lipid [inference]

response to estradiol

response to antibiotic [inference]

cellular response to antibiotic

cellular response to chemical stimulus [inference]

cellular response to antibiotic

cellular response to metal ion [inference]

cellular response to lithium ion

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

response to phenylpropanoid [inference]

response to hydroxyisoflavone [inference]

response to genistein

response to nitrogen compound [inference]

response to peptide hormone

response to oxygen-containing compound [inference]

response to carbohydrate [inference]

response to monosaccharide [inference]

response to hexose [inference]

response to glucose

response to ketone [inference]

response to hydroxyisoflavone [inference]

response to genistein

cellular response to stimulus [inference]

cellular response to stress [inference]

cellular response to hypoxia

cellular response to chemical stimulus [inference]

cellular response to antibiotic

cellular response to metal ion [inference]

cellular response to lithium ion

cellular response to oxygen levels [inference]

cellular response to decreased oxygen levels [inference]

cellular response to hypoxia

localization [inference]

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

potassium ion transport

intercellular transport [inference]

nuclear export

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export

establishment of localization in cell [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export

cellular localization [inference]

intracellular transport [inference]

nuclear transport [inference]

nucleocytoplasmic transport [inference]

nuclear export

biological regulation [inference]

regulation of biological process [inference]

regulation of growth [inference]

regulation of cell growth [inference]

negative regulation of cell growth

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

regulation of developmental growth [inference]

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

regulation of cardiac muscle tissue regeneration [inference]

negative regulation of cardiac muscle tissue regeneration

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of supramolecular fiber organization [inference]

positive regulation of microtubule polymerization

negative regulation of biological process [inference]

negative regulation of growth [inference]

negative regulation of cell growth

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

negative regulation of epithelial cell proliferation

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell growth

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of reproductive process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

regulation of lens fiber cell differentiation

regulation of developmental growth [inference]

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

regulation of cardiac muscle tissue regeneration [inference]

negative regulation of cardiac muscle tissue regeneration

negative regulation of developmental process [inference]

negative regulation of developmental growth [inference]

negative regulation of cardiac muscle tissue regeneration

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of lens fiber cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

Notch signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of catabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of protein metabolic process [inference]

regulation of protein catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

regulation of microtubule-based process [inference]

regulation of microtubule cytoskeleton organization [inference]

regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

regulation of microtubule polymerization [inference]

positive regulation of microtubule polymerization

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

negative regulation of cell population proliferation

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

negative regulation of epithelial cell proliferation

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of smooth muscle cell proliferation [inference]

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of vascular associated smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

regulation of epithelial cell proliferation [inference]

negative regulation of epithelial cell proliferation

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of epithelial cell proliferation involved in prostate gland development [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

regulation of epithelial cell apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

regulation of cellular component biogenesis [inference]

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

regulation of protein polymerization [inference]

regulation of microtubule polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

regulation of lens fiber cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of metabolic process [inference]

positive regulation of catabolic process [inference]

positive regulation of protein catabolic process

positive regulation of macromolecule metabolic process [inference]

positive regulation of protein metabolic process [inference]

positive regulation of protein catabolic process

positive regulation of cellular component biogenesis [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of supramolecular fiber organization [inference]

positive regulation of microtubule polymerization

negative regulation of cellular process [inference]

negative regulation of cell population proliferation

negative regulation of smooth muscle cell proliferation [inference]

negative regulation of vascular associated smooth muscle cell proliferation

negative regulation of epithelial cell proliferation

negative regulation of epithelial cell proliferation involved in prostate gland development

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell growth

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process [inference]

negative regulation of epithelial cell apoptotic process

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

regulation of cellular component organization [inference]

regulation of cell growth [inference]

negative regulation of cell growth

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

regulation of cytoskeleton organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

regulation of microtubule cytoskeleton organization [inference]

regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

regulation of microtubule polymerization [inference]

positive regulation of microtubule polymerization

regulation of protein-containing complex assembly [inference]

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

regulation of protein polymerization [inference]

regulation of microtubule polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of microtubule polymerization or depolymerization [inference]

positive regulation of microtubule polymerization

positive regulation of protein-containing complex assembly [inference]

positive regulation of protein polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of supramolecular fiber organization [inference]

positive regulation of microtubule polymerization

regulation of supramolecular fiber organization [inference]

regulation of microtubule polymerization [inference]

positive regulation of microtubule polymerization

positive regulation of supramolecular fiber organization [inference]

positive regulation of microtubule polymerization

regulation of cell cycle

regulation of mitotic cell cycle

negative regulation of mitotic cell cycle

regulation of mitotic cell cycle phase transition [inference]

regulation of cell cycle process [inference]

regulation of cell cycle phase transition [inference]

regulation of mitotic cell cycle phase transition [inference]

regulation of cell cycle G1/S phase transition

regulation of G1/S transition of mitotic cell cycle

negative regulation of cell cycle [inference]

negative regulation of mitotic cell cycle

regulation of cell motility [inference]

regulation of cell migration

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of lens fiber cell differentiation

regulation of reproductive process [inference]

negative regulation of reproductive process [inference]

negative regulation of epithelial cell proliferation involved in prostate gland development

Displaying entries **1 - 5** of 16 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF
nucleus	IBA	GO_REF
nucleus	IEA	GO_REF GO_REF GO_REF
nucleoplasm	ISO	GO_REF
cytoplasm	ISO	GO_REF

GO Hierarchy

cellular component

protein-containing complex

intracellular protein-containing complex [inference]

ubiquitin ligase complex [inference]

cullin-RING ubiquitin ligase complex [inference]

Cul4-RING E3 ubiquitin ligase complex [inference]

Cul4A-RING E3 ubiquitin ligase complex

catalytic complex [inference]

transferase complex [inference]

ubiquitin ligase complex [inference]

cullin-RING ubiquitin ligase complex [inference]

Cul4-RING E3 ubiquitin ligase complex [inference]

Cul4A-RING E3 ubiquitin ligase complex

cellular anatomical structure [inference]

microtubule organizing center [inference]

cytosol

cell projection [inference]

plasma membrane bounded cell projection [inference]

cilium

organelle [inference]

membrane-bounded organelle [inference]

cilium

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
protein kinase inhibitor activity	ISO	GO_REF
cyclin-dependent protein serine/threonine kinase inhibitor activity	ISO	GO_REF
cyclin-dependent protein serine/threonine kinase inhibitor activity	IBA	GO_REF
cyclin-dependent protein serine/threonine kinase inhibitor activity	IEA	GO_REF GO_REF
protein kinase binding	ISO	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

enzyme binding [inference]

kinase binding [inference]

protein kinase binding

phosphatase binding [inference]

protein phosphatase binding

ubiquitin-like protein ligase binding [inference]

ubiquitin protein ligase binding

cyclin binding

heat shock protein binding [inference]

Hsp70 protein binding

protein-folding chaperone binding

Hsp70 protein binding

protein-containing complex binding

molecular adaptor activity

molecular function regulator activity [inference]

enzyme regulator activity [inference]

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

protein serine/threonine kinase inhibitor activity [inference]

cyclin-dependent protein serine/threonine kinase inhibitor activity

enzyme activator activity [inference]

ubiquitin-protein transferase activator activity [inference]

ubiquitin ligase activator activity

kinase regulator activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

protein serine/threonine kinase inhibitor activity [inference]

cyclin-dependent protein serine/threonine kinase inhibitor activity

protein kinase regulator activity [inference]

protein kinase inhibitor activity

protein serine/threonine kinase inhibitor activity [inference]

cyclin-dependent protein serine/threonine kinase inhibitor activity

cyclin-dependent protein kinase regulator activity

cyclin-dependent protein serine/threonine kinase regulator activity [inference]

cyclin-dependent protein serine/threonine kinase inhibitor activity

ubiquitin-protein transferase regulator activity [inference]

ubiquitin-protein transferase activator activity [inference]

ubiquitin ligase activator activity

molecular function activator activity [inference]

enzyme activator activity [inference]

ubiquitin-protein transferase activator activity [inference]

ubiquitin ligase activator activity

molecular function inhibitor activity

enzyme inhibitor activity [inference]

kinase inhibitor activity [inference]

protein kinase inhibitor activity

protein serine/threonine kinase inhibitor activity [inference]

cyclin-dependent protein serine/threonine kinase inhibitor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSNVRVSNGSPSLERMDARQTEHPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKWNFDFQNHKPLEGRYEWQEVERGSLPEFYYRPPRPPKSACKVPAQESLDVSGSRQAVPSIGSQANSEDRHLVDQMPDSSDSPAGLAEQCPGMRKRPAAEDSSSQNKRANRTEENVSDGSPNAGTVEQTPKKPGLRRQT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	PubMed ID	GlyTouCan ID	Source
2	26562163	G49108TO	GlyGen The O-GlcNAc Database
110	26562163	G49108TO	GlyGen The O-GlcNAc Database
197	26562163	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying entries **1 - 10** of 11 in total

1

2

Next ›

Last »
Pathway Name	Organism
AKT phosphorylates targets in the cytosol	Rattus norvegicus
Cyclin A:Cdk2-associated events at S phase entry	Rattus norvegicus
Cyclin D associated events in G1	Rattus norvegicus
Cyclin E associated events during G1/S transition	Rattus norvegicus
DNA Damage/Telomere Stress Induced Senescence	Rattus norvegicus
Estrogen-dependent nuclear events downstream of ESR-membrane signaling	Rattus norvegicus
PTK6 Regulates Cell Cycle	Rattus norvegicus
SCF(Skp2)-mediated degradation of p27/p21	Rattus norvegicus
Senescence-Associated Secretory Phenotype (SASP)	Rattus norvegicus
TP53 Regulates Transcription of Genes Involved in G1 Cell Cycle Arrest	Rattus norvegicus

Disease

Displaying **all 7** entries
DO ID	Disease Name	Source
DOID:0050773	paraganglioma	Alliance of Genome Resources
DOID:5844	myocardial infarction	Alliance of Genome Resources
DOID:5223	infertility	Alliance of Genome Resources
DOID:83	cataract	Alliance of Genome Resources
DOID:3125	multiple endocrine neoplasia	Alliance of Genome Resources
DOID:3829	pituitary adenoma	Alliance of Genome Resources
DOID:0050771	pheochromocytoma	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements