GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Protein nipi-4

Summary

UniProt ID: O16262
Gene Symbol: F40A3.5 nipi-4
Gene ID: 179167
Organism: Caenorhabditis elegans

External Links

Re-Glyco: O16262

Annotation

Keyword: ATP-binding Glycoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
response to wounding	IMP	PMID
positive regulation of gene expression	IMP	PMID
defense response to fungus	IMP	PMID

GO Hierarchy

biological process

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to fungus

response to wounding

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to fungus [inference]

defense response to fungus

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

Displaying 1 entry
GO Term	Evidence Code	Reference
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying **all 2** entries
GO Term	Evidence Code	Reference
protein kinase activity	IEA	GO_REF
ATP binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

transferase activity, transferring phosphorus-containing groups [inference]

kinase activity [inference]

protein kinase activity

phosphotransferase activity, alcohol group as acceptor [inference]

protein kinase activity

catalytic activity, acting on a protein [inference]

protein kinase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MELDHTPPPSVLNDNCSASYMTPYATVIAMSGLYLLAIFYFCKKSKKMCQPMSDSIYPYQKRLTQLERELKNYLIDEESIEVDDFQIGQTADGFIFRGGVFPKTRNRFNAKVTTAVKISFPIVSKSISLLEDALRLSKLDHPNLIRLLAVSQLSFTVFRPMIALEWLPGGTLADYFQFKVREKDDSERSPIQLKDMLSILYQVSQALKYIHSQLDEFGQELTHGRIFTRNVLVTEPDLRKCEVKLGDFGDAPMGLEYSTPIIAYMPPEILCCAERIPPHRPENDVWMFGVFIWECLTLGAQPHFRKSVEEIKKSFRLPDRGLSCPPTCPLDVWTLVSDCLSEPHMRPRFASTTNASITSRLSELHHIVSPALFLYAIPNQSVCTCIEHHCQSVIHY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
15	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 7** entries
Pathway Name	Organism
ERBB2 Activates PTK6 Signaling	Caenorhabditis elegans
PTK6 Down-Regulation	Caenorhabditis elegans
PTK6 Regulates Cell Cycle	Caenorhabditis elegans
PTK6 Regulates Proteins Involved in RNA Processing	Caenorhabditis elegans
PTK6 Regulates RHO GTPases, RAS GTPase and MAP kinases	Caenorhabditis elegans
PTK6 Regulates RTKs and Their Effectors AKT1 and DOK1	Caenorhabditis elegans
SCF(Skp2)-mediated degradation of p27/p21	Caenorhabditis elegans

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026