GlyCosmos Portal

Submissions

Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase

Summary

UniProt ID: O17560
Gene Symbol: gly-20 C03E10.4 CELE_C03E10.4
Gene ID: 179562
Organism: Caenorhabditis elegans

External Links

GlycoProtDB: GPDB0000420
Re-Glyco: O17560

Annotation

Keyword: Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Manganese Metal-binding Proteomics identification Reference proteome Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying **all 3** entries
GO Term	Evidence Code	Reference
protein N-linked glycosylation	IMP	PMID
protein N-linked glycosylation	IBA	GO_REF
oligosaccharide biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

oligosaccharide metabolic process [inference]

oligosaccharide biosynthetic process

carbohydrate biosynthetic process [inference]

oligosaccharide biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

protein N-linked glycosylation

Displaying **all 3** entries
GO Term	Evidence Code	Reference
Golgi membrane	IBA	GO_REF
Golgi membrane	IEA	GO_REF
Golgi stack	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle subcompartment [inference]

Golgi apparatus subcompartment [inference]

Golgi stack

Displaying **all 2** entries
GO Term	Evidence Code	Reference
alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity	IEA	GO_REF GO_REF
metal ion binding

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

acetylglucosaminyltransferase activity [inference]

alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity

hexosyltransferase activity [inference]

acetylglucosaminyltransferase activity [inference]

alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity

catalytic activity, acting on a protein [inference]

catalytic activity, acting on a glycoprotein [inference]

alpha-1,6-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MMVYRRMHRLANAVIACCLFGFIVIFLKAPGEDQRLRDGVPVLSQNPVWSVNDWNGLNKEVVDLLKNESNRLSINEKPDLSGWNFKTKEDMSLKGSEIVESVSFLNENFDILNAAKFGDLSTVKTILVIQVHDRPVYLQYLIESMRNTKGIEDTLLVFSHDINVGIINEMIRNITFARVYQIFYPYNLQLFPTVFPGQSPSDCPEKMKRDKAQETNCSNWSSPDKYGNYRVAQLTQIKHHWWWKMNFVFDGIVEKYSMKDPWVLLLEEDHMLAPDALHVLDIIVSNRPKYCENCEIISLGFYLKSTNKYGQDIAHLGVHPWYSSKHNMGMALQKNTWQKIKGCSEMFCKWDDYNWDWSLMQISAKCLPQRFRVIFTKSPRVIHIGDCGVHTHRCEAHKALQSTQELFRQHKDLLFPTSLSVTDTSRRSLKPSKENGGWGDIRDRQLCEINKSPLVRVSSQSASVLHKLLNSKIQFSSSNKTITSTTS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
67				GlycoProtDB

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Reactions specific to the complex N-glycan synthesis pathway	Caenorhabditis elegans

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:2978	carbohydrate metabolic disorder	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements