GlyCosmos Portal

Submissions

Rhodopsin

Summary

UniProt ID: O18766
Gene Symbol: RHO RHO1
Gene ID: 397437
Organism: Sus scrofa (pig)

External Links

PubChem: O18766
Re-Glyco: O18766

Annotation

Keyword: Acetylation Cell projection Disulfide bond G-protein coupled receptor Glycoprotein Metal-binding Palmitate Phosphoprotein Reference proteome Retinal protein Transmembrane helix Vision Zinc

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
microtubule cytoskeleton organization
G protein-coupled receptor signaling pathway	ISS	GO_REF
G protein-coupled receptor signaling pathway	IBA	GO_REF
G protein-coupled receptor signaling pathway	IEA	GO_REF GO_REF
visual perception	IEA	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

microtubule-based process [inference]

microtubule cytoskeleton organization

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

G protein-coupled opsin signaling pathway

metabolic process [inference]

biosynthetic process [inference]

macromolecule biosynthetic process [inference]

gene expression

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

gene expression

light absorption [inference]

absorption of visible light

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

cytoskeleton organization [inference]

microtubule cytoskeleton organization

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

cellular component assembly [inference]

protein-containing complex assembly [inference]

podosome assembly

organelle assembly [inference]

membraneless organelle assembly [inference]

podosome assembly

protein-containing complex organization [inference]

protein-containing complex assembly [inference]

podosome assembly

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of light stimulus [inference]

visual perception

photoreceptor cell maintenance

developmental process [inference]

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation [inference]

glutamatergic neuron differentiation [inference]

retinal bipolar neuron differentiation [inference]

rod bipolar cell differentiation

locomotion [inference]

taxis [inference]

thermotaxis

response to stimulus [inference]

response to external stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

response to abiotic stimulus [inference]

response to temperature stimulus [inference]

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

thermotaxis

response to radiation [inference]

response to light stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

response to light intensity

cellular response to light stimulus

G protein-coupled opsin signaling pathway

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

detection of stimulus [inference]

detection of external stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of abiotic stimulus [inference]

detection of light stimulus [inference]

phototransduction

G protein-coupled opsin signaling pathway

detection of temperature stimulus [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

detection of stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in sensory perception [inference]

detection of temperature stimulus involved in thermoception

cellular response to stimulus [inference]

cellular response to environmental stimulus [inference]

cellular response to abiotic stimulus [inference]

cellular response to radiation [inference]

cellular response to light stimulus

G protein-coupled opsin signaling pathway

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

G protein-coupled opsin signaling pathway

phototransduction

G protein-coupled opsin signaling pathway

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
photoreceptor outer segment	IBA	GO_REF
photoreceptor outer segment	IEA	GO_REF GO_REF
Golgi apparatus	IEA	GO_REF
plasma membrane	ISS	GO_REF
plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

photoreceptor outer segment

rod photoreceptor outer segment

membrane

plasma membrane

organelle membrane [inference]

photoreceptor disc membrane

bounding membrane of organelle [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

plasma membrane region [inference]

cell projection membrane [inference]

ciliary membrane [inference]

photoreceptor outer segment membrane

cell junction [inference]

anchoring junction [inference]

cell-cell junction

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

sperm midpiece

Displaying **all 4** entries
GO Term	Evidence Code	Reference
11-cis retinal binding	ISS	GO_REF
G protein-coupled photoreceptor activity	ISS	GO_REF
G protein-coupled photoreceptor activity	IBA	GO_REF
metal ion binding

GO Hierarchy

molecular function

binding [inference]

lipid binding [inference]

isoprenoid binding [inference]

retinoid binding [inference]

retinal binding [inference]

11-cis retinal binding

small molecule binding [inference]

vitamin binding [inference]

retinal binding [inference]

11-cis retinal binding

ion binding [inference]

cation binding [inference]

metal ion binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled photoreceptor activity

photoreceptor activity [inference]

G protein-coupled photoreceptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MNGTEGPNFYVPFSNKTGVVRSPFEYPQYYLAEPWQFSMLAAYMFMLIVLGFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGLALTWVMALACAAPPLVGWSRYIPEGLQCSCGIDYYTLKPEVNNESFVIYMFVVHFSIPLVIIFFCYGQLVFTVKEAAAQQQESATTQKAEKEVTRMVIIMVVAFLICWLPYASVAFYIFTHQGSDFGPIFMTIPAFFAKSASIYNPVIYIMMNKQFRNCMLTTLCCGKNPLGDDEASTTTSKTETSQVAPA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
2	N-linked (GlcNAc...) asparagine			UniProt
15	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Activation of the phototransduction cascade	Sus scrofa
G alpha (i) signalling events	Sus scrofa
Inactivation, recovery and regulation of the phototransduction cascade	Sus scrofa
Opsins	Sus scrofa
The canonical retinoid cycle in rods (twilight vision)	Sus scrofa
VxPx cargo-targeting to cilium	Sus scrofa

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements