GlyCosmos Portal

Submissions

Acyloxyacyl hydrolase [Cleaved into: Acyloxyacyl hydrolase small subunit; Acyloxyacyl hydrolase large subunit]

Summary

UniProt ID: O18823
Gene Symbol: AOAH
Gene ID: 100008662
Organism: Oryctolagus cuniculus (rabbit)

External Links

PubChem: O18823
Re-Glyco: O18823

Annotation

Keyword: 3D-structure Calcium Cytoplasmic vesicle Disulfide bond Glycoprotein Hydrolase Lipid metabolism Metal-binding Reference proteome Secreted Signal Zymogen

Gene Ontology (GO)

Displaying **all 4** entries
GO Term	Evidence Code	Reference
fatty acid metabolic process	ISS	GO_REF
lipopolysaccharide catabolic process	ISS	GO_REF
lipopolysaccharide catabolic process	IEA	GO_REF
negative regulation of inflammatory response	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

lipopolysaccharide catabolic process

lipid catabolic process [inference]

lipopolysaccharide catabolic process

carbohydrate derivative catabolic process [inference]

lipopolysaccharide catabolic process

macromolecule metabolic process [inference]

lipopolysaccharide metabolic process [inference]

lipopolysaccharide catabolic process

macromolecule catabolic process [inference]

lipopolysaccharide catabolic process

primary metabolic process [inference]

lipid metabolic process [inference]

fatty acid metabolic process

lipid catabolic process [inference]

lipopolysaccharide catabolic process

liposaccharide metabolic process [inference]

lipopolysaccharide metabolic process [inference]

lipopolysaccharide catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

monocarboxylic acid metabolic process [inference]

fatty acid metabolic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative catabolic process [inference]

lipopolysaccharide catabolic process

liposaccharide metabolic process [inference]

lipopolysaccharide metabolic process [inference]

lipopolysaccharide catabolic process

biological regulation [inference]

regulation of biological process [inference]

negative regulation of biological process [inference]

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stimulus [inference]

regulation of response to external stimulus [inference]

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

negative regulation of response to stimulus [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

negative regulation of response to external stimulus [inference]

negative regulation of inflammatory response

regulation of response to stress [inference]

regulation of defense response [inference]

negative regulation of defense response [inference]

negative regulation of inflammatory response

regulation of inflammatory response [inference]

negative regulation of inflammatory response

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF
cytoplasmic vesicle	ISS	GO_REF
cytoplasmic vesicle	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle

Displaying **all 4** entries
GO Term	Evidence Code	Reference
calcium ion binding	IDA	PMID
calcium ion binding	IEA	GO_REF GO_REF
acyloxyacyl hydrolase activity	ISS	GO_REF
acyloxyacyl hydrolase activity	IEA	GO_REF GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

hydrolase activity, acting on ester bonds [inference]

carboxylic ester hydrolase activity [inference]

acyloxyacyl hydrolase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKSPWRILVVSPLLLLPLHSSTSRAHDNQPGTIRSDHYTCVGCVLVVSVIEQLAQVHNSTVQASMERLCSYLPEEWVLKTACYMMVHVFGADIIKLFDKDVNADVVCHTLEFCKQEPGQPLCHLYPLPKESWKFTLEKARHIVKQSPIMKYTRSGAGICSLPFLAKICQKIKLAIKNSVPIKDVDSDKYSIFPTLRGYHWRGRDCNDSDKTVYPGRRPDNWDAHRDSNCNGIWGVDPKDGIPYEKKFCEGSQPRGIILLGDSAGAHFHIPPEWLTVSQMSVNSFLNLPTAVTNELDWPQLSGTTGFLDSASKIKENSIYLRLRKRNRCNHRDYQNISKNGASSRNVKSLIESLSRNQLLDHPAIVIYAMIGNDVCNGRKTDPVSAMTTPEQLYANVLKMLEALNSHLPTGSHVILYGLAHGAFLWDTLHSRYHPLGQLNKDVTYTQLYSFLGCLQVSPCPGWMSANETLRALTSERAQQLSETLRKIAASKKFTNFNLFYLDFAFQEVVEEWQKMGGQPWELIEAVDGFHPNEVALLLFADQLWEKVQRQWPDVLGKENPFNPQIEEVFGDQGGH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites