GlyCosmos Portal

Submissions

Collagenase 3

Summary

UniProt ID: O18927
Gene Symbol: MMP13
Gene ID: 100009711
Organism: Equus caballus (horse)

External Links

PubChem: O18927
Re-Glyco: O18927

Annotation

Keyword: Calcium Collagen degradation Disulfide bond Extracellular matrix Glycoprotein Metal-binding Metalloprotease Phosphoprotein Reference proteome Repeat Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
proteolysis	IEA	GO_REF
extracellular matrix disassembly	ISS	GO_REF
extracellular matrix organization	IBA	GO_REF
collagen catabolic process	ISS	GO_REF
collagen catabolic process	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

collagen catabolic process

collagen metabolic process [inference]

collagen catabolic process

macromolecule metabolic process [inference]

protein metabolic process [inference]

proteolysis

primary metabolic process [inference]

protein metabolic process [inference]

proteolysis

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component disassembly [inference]

extracellular matrix disassembly

extracellular structure organization [inference]

extracellular matrix organization

extracellular matrix disassembly

external encapsulating structure organization [inference]

extracellular matrix organization

extracellular matrix disassembly

developmental process [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

bone morphogenesis

Displaying **all 2** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
extracellular matrix	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

external encapsulating structure [inference]

extracellular matrix

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
endopeptidase activity	ISS	GO_REF
metalloendopeptidase activity	ISS	GO_REF
metalloendopeptidase activity	IEA	GO_REF
calcium ion binding	ISS	GO_REF
collagen binding	ISS	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

calcium ion binding

transition metal ion binding [inference]

zinc ion binding

protein-containing complex binding [inference]

collagen binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MHPGVLAAFLFLSWTRCWSLPVPNDDDDDDDMSEEDFQLAERYLKSYYYPLNPAGILKKTAANSVVDRLREMQSFFGLEVTGKLDDNTLDIMKKPRCGVPDVGEYNVFPRTLKWPKMNLTYRIVNYTPDLTHSEVEKAFKKAFKVWSDVTPLNFTRLYNGTADIMISFGTKEHGDFYPFDGPSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALMFPIYTYTGKSHFVLPDDDVQGIQYLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGETMVFKDRFFWRLHPQLVDAELFLTKSFWPELPNRIDAAYEHPSKDLIFIFRGRKFWALNGYDILEGYPQKISELGFPKDVKKISAAVHFEDTGKTLFFSGNQVWRYDDTNRMMDKDYPRLIEEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPTNSLLWC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites