GlyCosmos Portal

Submissions

Prohibitin-2

Summary

UniProt ID: O35129
Gene Symbol: Phb2 Bap Bcap37 Rea
Gene ID: 12034
Organism: Mus musculus (house mouse)

External Links

GlyGen: O35129
PubChem: O35129
RaftProt: O35129
Re-Glyco: O35129

Annotation

Keyword: Acetylation Cell membrane Coiled coil Cytoplasm Direct protein sequencing Mitochondrion inner membrane Nucleus Phosphoprotein Receptor Reference proteome Repressor Transcription regulation

Gene Ontology (GO)

Displaying entries **1 - 5** of 42 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
mitophagy	ISO	GO_REF
mitophagy	IDA	PMID
mitophagy	IEA	GO_REF
positive regulation of immunoglobulin production	IDA	PMID
positive regulation of immunoglobulin production	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response [inference]

innate immune response [inference]

antiviral innate immune response

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

cellular process [inference]

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

metabolic process [inference]

catabolic process [inference]

autophagy [inference]

autophagy of mitochondrion [inference]

mitophagy

macroautophagy [inference]

mitophagy

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

cell cycle process [inference]

sister chromatid cohesion

cell motility [inference]

cell migration

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

process utilizing autophagic mechanism [inference]

autophagy [inference]

autophagy of mitochondrion [inference]

mitophagy

macroautophagy [inference]

mitophagy

cellular component organization or biogenesis [inference]

cellular component organization [inference]

organelle organization [inference]

mitochondrion organization

chromosome organization [inference]

sister chromatid cohesion

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in mammary gland duct morphogenesis [inference]

mammary gland branching involved in thelarche

cell activation [inference]

leukocyte activation [inference]

lymphocyte activation [inference]

B cell activation

developmental process [inference]

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in mammary gland duct morphogenesis [inference]

mammary gland branching involved in thelarche

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in mammary gland duct morphogenesis [inference]

mammary gland branching involved in thelarche

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube [inference]

branching involved in mammary gland duct morphogenesis [inference]

mammary gland branching involved in thelarche

anatomical structure development [inference]

animal gross anatomical part developmental process [inference]

mammary gland alveolus development

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

immune response [inference]

innate immune response [inference]

antiviral innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to virus [inference]

defense response to virus [inference]

antiviral innate immune response

defense response to other organism [inference]

defense response to symbiont [inference]

innate immune response [inference]

antiviral innate immune response

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

protein localization to organelle [inference]

protein localization to nucleus [inference]

protein import into nucleus

establishment of localization [inference]

transport [inference]

intercellular transport [inference]

import into nucleus [inference]

protein import into nucleus

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

establishment of protein localization [inference]

protein transport [inference]

intracellular protein transport [inference]

protein import into nucleus

establishment of protein localization to organelle [inference]

protein import into nucleus

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport [inference]

protein import into nucleus

nuclear transport [inference]

nucleocytoplasmic transport [inference]

import into nucleus [inference]

protein import into nucleus

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of immune effector process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular estrogen receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of localization [inference]

regulation of transport [inference]

regulation of transmembrane transport [inference]

regulation of transmembrane transporter activity [inference]

regulation of cytochrome-c oxidase activity

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of cytochrome-c oxidase activity

regulation of monoatomic ion transport [inference]

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of cytochrome-c oxidase activity

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of immune effector process [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

negative regulation of biological process [inference]

negative regulation of signaling [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of mammary gland epithelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

negative regulation of multicellular organismal process [inference]

negative regulation of mammary gland epithelial cell proliferation

regulation of response to stimulus [inference]

regulation of response to biotic stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular estrogen receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to stimulus [inference]

positive regulation of response to biotic stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of response to external stimulus [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

negative regulation of response to stimulus [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of response to stress [inference]

regulation of defense response [inference]

positive regulation of defense response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of innate immune response [inference]

positive regulation of innate immune response [inference]

activation of innate immune response [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of developmental process [inference]

regulation of anatomical structure morphogenesis [inference]

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in mammary gland duct morphogenesis

regulation of morphogenesis of an epithelium [inference]

regulation of branching involved in mammary gland duct morphogenesis

regulation of animal organ morphogenesis [inference]

regulation of branching involved in mammary gland duct morphogenesis

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

innate immune response-activating signaling pathway [inference]

pattern recognition receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

intracellular signal transduction [inference]

intracellular receptor signaling pathway [inference]

cytoplasmic pattern recognition receptor signaling pathway [inference]

RIG-I signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular signal transduction [inference]

regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of intracellular estrogen receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of non-canonical NF-kappaB signal transduction [inference]

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of phosphorus metabolic process [inference]

regulation of phospholipid metabolic process [inference]

regulation of cardiolipin metabolic process

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of production of molecular mediator of immune response [inference]

regulation of immunoglobulin production [inference]

positive regulation of immunoglobulin production

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of primary metabolic process [inference]

regulation of lipid metabolic process [inference]

regulation of phospholipid metabolic process [inference]

regulation of cardiolipin metabolic process

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

regulation of transmembrane transport [inference]

regulation of transmembrane transporter activity [inference]

regulation of cytochrome-c oxidase activity

regulation of monoatomic ion transmembrane transport [inference]

regulation of monoatomic cation transmembrane transport [inference]

regulation of proton transport [inference]

regulation of cytochrome-c oxidase activity

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of mammary gland epithelial cell proliferation

regulation of epithelial cell proliferation [inference]

regulation of mammary gland epithelial cell proliferation [inference]

negative regulation of mammary gland epithelial cell proliferation

negative regulation of epithelial cell proliferation [inference]

negative regulation of mammary gland epithelial cell proliferation

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

negative regulation of apoptotic process

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression [inference]

positive regulation of production of molecular mediator of immune response [inference]

positive regulation of immunoglobulin production

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of non-canonical NF-kappaB signal transduction

negative regulation of cellular process [inference]

negative regulation of cell population proliferation [inference]

negative regulation of epithelial cell proliferation [inference]

negative regulation of mammary gland epithelial cell proliferation

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of cell communication [inference]

negative regulation of signal transduction [inference]

negative regulation of intracellular signal transduction [inference]

negative regulation of intracellular steroid hormone receptor signaling pathway [inference]

negative regulation of intracellular estrogen receptor signaling pathway

negative regulation of programmed cell death [inference]

negative regulation of apoptotic process

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of mammary gland epithelial cell proliferation

regulation of morphogenesis of a branching structure [inference]

regulation of branching involved in mammary gland duct morphogenesis

regulation of biological quality [inference]

regulation of protein stability [inference]

protein stabilization

regulation of molecular function [inference]

regulation of transmembrane transporter activity [inference]

regulation of cytochrome-c oxidase activity

regulation of catalytic activity [inference]

regulation of oxidoreductase activity [inference]

regulation of cytochrome-c oxidase activity

Displaying entries **1 - 5** of 41 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
nucleus	ISO	GO_REF GO_REF
nucleus	IDA	PMID PMID
nucleus	IEA	GO_REF GO_REF
cytoplasm	ISO	GO_REF GO_REF
cytoplasm	EXP	PMID

GO Hierarchy

cellular component

protein-containing complex

membrane protein complex [inference]

inner mitochondrial membrane protein complex

mitochondrial prohibitin complex

mitochondrial protein-containing complex [inference]

inner mitochondrial membrane protein complex

mitochondrial prohibitin complex

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

outer membrane [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

organelle membrane [inference]

organelle inner membrane [inference]

mitochondrial inner membrane

mitochondrial membrane [inference]

bounding membrane of organelle [inference]

organelle outer membrane [inference]

mitochondrial outer membrane

nuclear matrix

cell junction [inference]

synapse [inference]

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

axon

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

postsynaptic specialization [inference]

postsynaptic density

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
identical protein binding	ISO	GO_REF
identical protein binding	IEA	GO_REF
protein homodimerization activity	ISS	GO_REF
protein homodimerization activity	ISO	GO_REF
protein homodimerization activity	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

lipid binding [inference]

sphingolipid binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites