GlyCosmos Portal

Submissions

Protein Wnt-9b

Summary

UniProt ID: O35468
Gene Symbol: Wnt14b Wnt15 Wnt9b
Gene ID: 22412
Organism: Mus musculus (house mouse)

External Links

Re-Glyco: O35468

Annotation

Keyword: Developmental protein Disulfide bond Extracellular matrix Glycoprotein Lipoprotein Reference proteome Signal Wnt signaling pathway

Gene Ontology (GO)

Displaying entries **1 - 5** of 43 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
branching involved in ureteric bud morphogenesis	IMP	PMID
branching involved in ureteric bud morphogenesis	IGI	PMID
in utero embryonic development	IMP	PMID
kidney development	IMP	PMID
regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

cell communication [inference]

cell-cell signaling

signal transduction

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

non-canonical Wnt signaling pathway

Wnt signaling pathway, planar cell polarity pathway

canonical Wnt signaling pathway

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

central nervous system neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

dopaminergic neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

cell fate commitment

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

reproductive process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

uterus morphogenesis

multicellular organismal process [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

branching involved in ureteric bud morphogenesis

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

stem cell population maintenance [inference]

somatic stem cell population maintenance [inference]

mesenchymal stem cell maintenance involved in nephron morphogenesis

developmental process [inference]

developmental process involved in reproduction [inference]

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

uterus morphogenesis

anatomical structure morphogenesis [inference]

morphogenesis of a branching structure [inference]

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

branching involved in ureteric bud morphogenesis

establishment of tissue polarity [inference]

establishment of planar polarity [inference]

establishment of planar polarity involved in nephron morphogenesis

animal organ morphogenesis

embryonic organ morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic cranial skeleton morphogenesis

skeletal system morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic cranial skeleton morphogenesis

tube morphogenesis [inference]

branching morphogenesis of an epithelial tube

branching involved in ureteric bud morphogenesis

epithelial tube morphogenesis [inference]

renal tubule morphogenesis [inference]

nephron tubule morphogenesis

mesonephric tubule morphogenesis [inference]

mesonephric duct morphogenesis [inference]

mesonephric duct formation

nephric duct morphogenesis [inference]

mesonephric duct morphogenesis [inference]

mesonephric duct formation

embryonic morphogenesis [inference]

embryonic organ morphogenesis [inference]

embryonic skeletal system morphogenesis [inference]

embryonic cranial skeleton morphogenesis

tissue morphogenesis [inference]

morphogenesis of an epithelium [inference]

epithelial tube morphogenesis [inference]

renal tubule morphogenesis [inference]

nephron tubule morphogenesis

mesonephric tubule morphogenesis [inference]

mesonephric duct morphogenesis [inference]

mesonephric duct formation

nephric duct morphogenesis [inference]

mesonephric duct morphogenesis [inference]

mesonephric duct formation

morphogenesis of a branching epithelium [inference]

branching morphogenesis of an epithelial tube

branching involved in ureteric bud morphogenesis

nephron epithelium morphogenesis [inference]

nephron tubule morphogenesis

mesonephric tubule morphogenesis [inference]

mesonephric duct morphogenesis [inference]

mesonephric duct formation

anatomical structure formation involved in morphogenesis [inference]

tube formation [inference]

epithelial tube formation [inference]

embryonic epithelial tube formation [inference]

nephron tubule formation [inference]

mesonephric tubule formation [inference]

mesonephric duct formation

metanephric tubule formation

nephric duct formation [inference]

mesonephric duct formation

kidney rudiment formation

anatomical structure development [inference]

multicellular organism development [inference]

embryo development [inference]

embryo development ending in birth or egg hatching [inference]

chordate embryonic development [inference]

in utero embryonic development

tissue development [inference]

epithelium development [inference]

kidney epithelium development [inference]

mesonephric epithelium development [inference]

mesonephric tubule development

metanephric epithelium development [inference]

metanephric tubule development

tube development [inference]

animal organ development [inference]

kidney development

genitalia development [inference]

male genitalia development

reproductive structure development [inference]

genitalia development [inference]

male genitalia development

system development [inference]

reproductive system development [inference]

male genitalia development

roof of mouth development

cellular developmental process [inference]

cell differentiation [inference]

neuron differentiation

central nervous system neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

dopaminergic neuron differentiation [inference]

midbrain dopaminergic neuron differentiation

cell fate commitment

maintenance of cell number [inference]

stem cell population maintenance [inference]

somatic stem cell population maintenance [inference]

mesenchymal stem cell maintenance involved in nephron morphogenesis

response to stimulus [inference]

response to stress [inference]

cellular response to stress [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

response to nutrient levels [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

response to starvation [inference]

cellular response to starvation

cellular response to stimulus [inference]

cellular response to nutrient levels [inference]

cellular response to starvation

cellular response to stress [inference]

cellular response to starvation

biological regulation [inference]

regulation of biological process [inference]

signaling [inference]

cell-cell signaling

negative regulation of biological process [inference]

negative regulation of developmental process [inference]

negative regulation of stem cell population maintenance

negative regulation of multicellular organismal process [inference]

negative regulation of stem cell population maintenance

regulation of developmental process [inference]

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis

negative regulation of developmental process [inference]

negative regulation of stem cell population maintenance

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis

regulation of stem cell population maintenance [inference]

negative regulation of stem cell population maintenance

regulation of cellular process [inference]

signal transduction

cell surface receptor signaling pathway [inference]

Wnt signaling pathway

non-canonical Wnt signaling pathway

Wnt signaling pathway, planar cell polarity pathway

canonical Wnt signaling pathway

regulation of cell differentiation [inference]

regulation of epithelial cell differentiation [inference]

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis

regulation of cell division [inference]

regulation of asymmetric cell division

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of stem cell population maintenance

regulation of multicellular organismal development [inference]

regulation of epithelial cell differentiation [inference]

regulation of epithelial cell differentiation involved in kidney development [inference]

regulation of mesenchymal to epithelial transition involved in metanephros morphogenesis

regulation of stem cell population maintenance [inference]

negative regulation of stem cell population maintenance

regulation of biological quality [inference]

regulation of anatomical structure size [inference]

regulation of tube size

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF
extracellular region	TAS	Reactome
extracellular region	IEA	GO_REF GO_REF
obsolete extracellular space

GO Hierarchy

cellular component

protein-containing complex [inference]

membrane protein complex [inference]

plasma membrane protein complex [inference]

Wnt-Frizzled-LRP5/6 complex

cellular anatomical structure [inference]

extracellular region

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
signaling receptor binding	TAS	PMID
signaling receptor binding	IPI	PMID
signaling receptor binding	IEA	GO_REF
frizzled binding	IBA	GO_REF
cytokine activity	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

signaling receptor binding

G protein-coupled receptor binding [inference]

frizzled binding

co-receptor binding

molecular function regulator activity [inference]

signaling receptor regulator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

cytokine activity

molecular function activator activity [inference]

signaling receptor activator activity [inference]

receptor ligand activity

cytokine activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites