GlyCosmos Portal

Submissions

Alpha-2,8-sialyltransferase 8B

Summary

UniProt ID

O35696

Gene Symbol

Siat8b
St8sia2
Stx

Gene ID

[20450]

Organism

Mus musculus (house mouse)

External Links

GlycoProtDB: GPDB0003130
PubChem: O35696
Re-Glyco: O35696

Annotation

Keyword: Cell membrane Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Nucleotide-binding Reference proteome Secreted Signal-anchor Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 19 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
ganglioside biosynthetic process	ISO	GO_REF
ganglioside biosynthetic process	IEA	GO_REF
N-glycan processing	ISO	GO_REF
N-glycan processing	IBA	GO_REF
N-glycan processing	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

ceramide biosynthetic process [inference]

ganglioside biosynthetic process

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

macromolecule metabolic process [inference]

macromolecule biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

macromolecule modification [inference]

sialylation

primary metabolic process [inference]

carbohydrate metabolic process [inference]

oligosaccharide metabolic process

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

ceramide biosynthetic process [inference]

ganglioside biosynthetic process

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

ceramide biosynthetic process [inference]

ganglioside biosynthetic process

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

ceramide biosynthetic process [inference]

ganglioside biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

protein metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative metabolic process [inference]

glycoprotein metabolic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

carbohydrate derivative biosynthetic process [inference]

glycoprotein biosynthetic process [inference]

N-glycan processing

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process [inference]

ganglioside biosynthetic process

cell growth [inference]

developmental cell growth [inference]

neuron projection extension

growth [inference]

cell growth [inference]

developmental cell growth [inference]

neuron projection extension

developmental growth [inference]

developmental cell growth [inference]

neuron projection extension

developmental growth involved in morphogenesis [inference]

neuron projection extension

response to stimulus [inference]

response to chemical [inference]

response to nitrogen compound [inference]

response to alkaloid [inference]

response to cocaine

response to oxygen-containing compound [inference]

response to cocaine

biological regulation [inference]

regulation of biological process [inference]

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of developmental process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of developmental process [inference]

positive regulation of developmental process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of cellular process [inference]

regulation of programmed cell death [inference]

regulation of apoptotic process [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of neuron apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

regulation of cellular component biogenesis [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular process [inference]

positive regulation of programmed cell death [inference]

positive regulation of apoptotic process [inference]

positive regulation of neuron apoptotic process

positive regulation of cellular component biogenesis [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cellular component organization [inference]

regulation of synapse organization [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cellular component organization [inference]

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of cell junction assembly [inference]

regulation of synapse assembly [inference]

positive regulation of synapse assembly

positive regulation of cell junction assembly [inference]

positive regulation of synapse assembly

regulation of multicellular organismal process [inference]

positive regulation of multicellular organismal process [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

regulation of multicellular organismal development [inference]

regulation of nervous system development [inference]

positive regulation of nervous system development [inference]

positive regulation of synapse assembly

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
Golgi membrane	ISS	GO_REF
Golgi membrane	ISO	GO_REF
Golgi membrane	IEA	GO_REF
extracellular region	ISS	GO_REF
extracellular region	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

organelle membrane [inference]

bounding membrane of organelle [inference]

Golgi membrane

organelle [inference]

membrane-bounded organelle [inference]

vesicle [inference]

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular vesicle [inference]

cytoplasmic vesicle [inference]

endosome [inference]

perinuclear region of cytoplasm

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
nucleotide binding
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	ISO	GO_REF
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IDA	PMID PMID
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IBA	GO_REF
alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

sialyltransferase activity

alpha-N-acetylneuraminate alpha-2,8-sialyltransferase activity

binding [inference]

small molecule binding [inference]

heterocyclic compound binding [inference]

nucleotide binding

nucleoside phosphate binding [inference]

nucleotide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MQLQFRSWMLAALTLLVVFLIFADISEIEEEIGNSGGRGTIRSAVNSLHSKSNRAEVVINGSSPPAVADRSNESLKHNIQPASSKWRHNQTLSLRIRKQILKFLDAEKDISVLKGTLKPGDIIHYIFDRDSTMNVSQNLYELLPRTSPLKNKHFQTCAIVGNSGVLLNSGCGQEIDTHSFVIRCNLAPVQEYARDVGLKTDLVTMNPSVIQRAFEDLVNATWREKLLQRLHGLNGSILWIPAFMARGGKERVEWVNALILKHHVNVRTAYPSLRLLHAVRGYWLTNKVHIKRPTTGLLMYTLATRFCNQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQASPHTMPLEFKALKSLHEQGALKLTVGQCDGAT

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
60	N-linked (GlcNAc...) asparagine	UniProt
72	N-linked (GlcNAc...) asparagine	UniProt
89	N-linked (GlcNAc...) asparagine	GlycoProtDB UniProt
134	N-linked (GlcNAc...) asparagine	UniProt
219	N-linked (GlcNAc...) asparagine	UniProt
234	N-linked (GlcNAc...) asparagine	UniProt