GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Chemerin-like receptor 1

Summary

UniProt ID

O35786

Gene Symbol

Cmklr1
Dez

Gene ID

60669

Organism

Rattus norvegicus (Norway rat)

External Links

PubChem: O35786
Re-Glyco: O35786

Annotation

Keyword: Cell membrane Disulfide bond G-protein coupled receptor Glycoprotein Phosphoprotein Reference proteome Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 22 in total

1

2

3

4

5

Next ›

Last »
GO Term	Evidence Code	Reference
complement receptor mediated signaling pathway	IBA	GO_REF
chemotaxis	ISS	GO_REF
chemotaxis	ISO	GO_REF
chemotaxis	IBA	GO_REF
inflammatory response	IBA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

locomotion [inference]

taxis [inference]

chemotaxis

response to stimulus [inference]

response to stress [inference]

defense response [inference]

inflammatory response

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage migration [inference]

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of locomotion [inference]

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage migration [inference]

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of biological process [inference]

positive regulation of immune system process [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

positive regulation of locomotion [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of multicellular organismal process [inference]

positive regulation of cold-induced thermogenesis

negative regulation of biological process [inference]

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of response to external stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of chemotaxis [inference]

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of response to stimulus [inference]

positive regulation of response to external stimulus [inference]

positive regulation of chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

regulation of immune response [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

positive regulation of immune response [inference]

activation of immune response [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of developmental process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of cellular process [inference]

signal transduction [inference]

immune response-regulating signaling pathway [inference]

immune response-activating signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

cell surface receptor signaling pathway [inference]

immune response-regulating cell surface receptor signaling pathway [inference]

immune response-activating cell surface receptor signaling pathway [inference]

complement receptor mediated signaling pathway

G protein-coupled receptor signaling pathway

phospholipase C-activating G protein-coupled receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of intracellular signal transduction [inference]

regulation of calcium-mediated signaling

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of cell differentiation [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

regulation of fat cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of cellular process [inference]

positive regulation of cell differentiation [inference]

positive regulation of fat cell differentiation

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of leukocyte migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of leukocyte chemotaxis [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of granulocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

regulation of mononuclear cell migration [inference]

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of macrophage migration [inference]

regulation of macrophage chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

positive regulation of cell motility [inference]

positive regulation of cell migration [inference]

positive regulation of leukocyte migration [inference]

positive regulation of leukocyte chemotaxis [inference]

positive regulation of macrophage chemotaxis

positive regulation of mononuclear cell migration [inference]

positive regulation of macrophage migration [inference]

positive regulation of macrophage chemotaxis

regulation of multicellular organismal process [inference]

regulation of cytokine production [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of interleukin-12 production [inference]

negative regulation of interleukin-12 production

positive regulation of multicellular organismal process [inference]

positive regulation of cold-induced thermogenesis

negative regulation of multicellular organismal process [inference]

negative regulation of cytokine production [inference]

negative regulation of interleukin-12 production

regulation of cold-induced thermogenesis [inference]

positive regulation of cold-induced thermogenesis

regulation of biological quality [inference]

positive regulation of cytosolic calcium ion concentration

Displaying **all 4** entries
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	ISO	GO_REF
plasma membrane	IBA	GO_REF
plasma membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

plasma membrane

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
G protein-coupled chemoattractant receptor activity	TAS	PMID
complement receptor activity	IBA	GO_REF
G protein-coupled receptor activity	IBA	GO_REF
G protein-coupled receptor activity	IEA	GO_REF
adipokinetic hormone receptor activity	ISS	GO_REF

GO Hierarchy

molecular function

binding [inference]

hormone binding [inference]

peptide hormone binding [inference]

adipokinetic hormone binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

complement receptor activity

G protein-coupled receptor activity

G protein-coupled chemoattractant receptor activity

protein-hormone receptor activity [inference]

adipokinetic hormone receptor activity

immune receptor activity [inference]

complement receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MEYEGYNDSSIYGEEYSDGSDYIVDLEEAGPLEAKVAEVFLVVIYSLVCFLGILGNGLVIVIATFKMKKTVNTVWFVNLAVADFLFNIFLPIHITYAAMDYHWVFGKAMCKISSFLLSHNMYTSVFLLTVISFDRCISVLLPVWSQNHRSVRLAYMTCVVVWVLAFFLSSPSLVFRDTVSTSHGKITCFNNFSLAAPEPFSHSTHPRTDPVGYSRHVAVTVTRFLCGFLIPVFIITACYLTIVFKLQRNRLAKTKKPFKIIITIIITFFLCWCPYHTLYLLELHHTAVPASVFSLGLPLATAVAIANSCMNPILYVFMGHDFKKFKVALFSRLVNALSEDTGPSSYPSHRSFTKMSSLIEKASVNEKETSTL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
7	N-linked (GlcNAc...) asparagine			UniProt
191	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying 1 entry
Pathway Name	Organism
Class A/1 (Rhodopsin-like receptors)	Rattus norvegicus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026