GlyCosmos Portal

Submissions

Sodium-dependent serotonin transporter

Summary

UniProt ID: O35899
Gene Symbol: SLC6A4
Gene ID: 100135619
Organism: Cavia porcellus (domestic guinea pig)

External Links

PubChem: O35899
Re-Glyco: O35899

Annotation

Keyword: Antiport Cell junction Cell membrane Cell projection Disulfide bond Endosome Glycoprotein Metal-binding Neurotransmitter transport Phosphoprotein Reference proteome Sodium Synapse Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amino acid transport	IEA	GO_REF
serotonin uptake	ISS	GO_REF
serotonin uptake	IEA	GO_REF
membrane depolarization	ISS	GO_REF
platelet aggregation	ISS	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cell adhesion [inference]

cell-cell adhesion [inference]

homotypic cell-cell adhesion [inference]

platelet aggregation

localization [inference]

establishment of localization [inference]

transport [inference]

neurotransmitter transport [inference]

neurotransmitter uptake [inference]

neurotransmitter reuptake [inference]

serotonin uptake

amino acid transport

organic hydroxy compound transport [inference]

serotonin uptake

nitrogen compound transport [inference]

serotonin uptake

import into cell [inference]

neurotransmitter uptake [inference]

neurotransmitter reuptake [inference]

serotonin uptake

establishment of localization in cell [inference]

neurotransmitter reuptake [inference]

serotonin uptake

biological regulation [inference]

regulation of biological quality [inference]

regulation of membrane potential [inference]

membrane depolarization

regulation of anatomical structure size [inference]

regulation of thalamus size

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
plasma membrane	ISS	GO_REF
plasma membrane	IEA	GO_REF GO_REF GO_REF
focal adhesion	ISS	GO_REF
focal adhesion	IEA	GO_REF
endosome membrane	ISS	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

endomembrane system

membrane [inference]

plasma membrane

organelle membrane [inference]

vesicle membrane [inference]

cytoplasmic vesicle membrane [inference]

endosome membrane

bounding membrane of organelle [inference]

endosome membrane

cell junction [inference]

synapse

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection

presynapse

Displaying entries **1 - 5** of 10 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
integrin binding	ISS	GO_REF
monoatomic cation channel activity	ISS	GO_REF
serotonin:sodium:chloride symporter activity	IMP	PMID
serotonin:sodium:chloride symporter activity	IEA	GO_REF GO_REF GO_REF
antiporter activity

GO Hierarchy

molecular function

transporter activity [inference]

transmembrane transporter activity [inference]

monoatomic ion transmembrane transporter activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity

monoatomic cation transmembrane transporter activity [inference]

monoatomic cation channel activity

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

metal ion transmembrane transporter activity [inference]

sodium ion transmembrane transporter activity [inference]

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

monoatomic anion transmembrane transporter activity [inference]

chloride transmembrane transporter activity [inference]

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

passive transmembrane transporter activity [inference]

channel activity [inference]

monoatomic ion channel activity [inference]

monoatomic cation channel activity

active transmembrane transporter activity [inference]

monoamine transmembrane transporter activity [inference]

serotonin:sodium:chloride symporter activity

secondary active transmembrane transporter activity [inference]

symporter activity [inference]

solute:monoatomic cation symporter activity [inference]

monoatomic anion:monoatomic cation symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

chloride:monoatomic cation symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

solute:sodium symporter activity [inference]

monoatomic anion:sodium symporter activity [inference]

sodium:chloride symporter activity [inference]

serotonin:sodium:chloride symporter activity

antiporter activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

integrin binding

cytoskeletal protein binding [inference]

actin binding [inference]

actin filament binding

identical protein binding

cell adhesion molecule binding [inference]

integrin binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

alkali metal ion binding [inference]

sodium ion binding

serotonin binding

heterocyclic compound binding [inference]

serotonin binding

amine binding [inference]

serotonin binding

protein-containing complex binding [inference]

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

METTALNSQKAPSVCKDREDCQENSILQKSGPTSAGGVESGQIFNGYSSVPSTGMGDDAEHSVPTATTTLVAEVHHGERETWGKKVDFLLSVIGYAVDLGNIWRFPYVCYQNGGGAFLLPYIIMAIFGGIPLFYMELALGQYHRNGCISIWRKICPIFKGIGYTICIIAFYIASYYNTIIAWALYYLISSFTDRLPWTSCRNSWNTANCTNYFSEDNITWTLHSTSPAEEFYIRHILQIHRSKGLQDVGGVSWQLTLCIMLIFTIIYFSIWKGVKTSGKVVWVTATFPYIVLSVLLVRGATLPGAWKGVLFYLKPNWQKLLETGVWIDAAAQIFFSLGPGFGVLLAFASYNKFNNNCYQDALVTSAVNCMTSFVSGFVIFTVLGYMAEMRSEDVSEVAKDAGPSLLFITYAEAIANMPASTFFAIIFFLMLITLGLDSTFAGLEGVITAVLDEFPHIWAKHREWFVLAVVITCFFGSLTTLTFGGAYVVKLLEEYATGPAVLTVVFIEAIAVSWFYGVTQFCSDVKEMLGFSPGWFWRICWVAVSPVFLLFIICSFLMSPPQLRLFQYSYPHWSVILGYCIGTSSVICIPTYITYRLVTTPGTLKERIIKSITPETPTEIPCGDICLNAV

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites