GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

Syndecan-4

Summary

UniProt ID: O35988
Gene Symbol: Sdc4
Gene ID: 20971
Organism: Mus musculus (house mouse)

External Links

GlyGen: O35988
PubChem: O35988
Re-Glyco: O35988

Annotation

Keyword: Heparan sulfate Reference proteome Secreted Signal Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 17 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
ureteric bud development	IEA	GO_REF
neural tube closure	IGI	PMID
regulation of fibroblast migration	IMP	PMID
cell migration
wound healing	IGI	PMID

GO Hierarchy

biological process

cellular process [inference]

cell motility [inference]

cell migration

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

plasma membrane bounded cell projection organization [inference]

neuron projection development [inference]

inner ear receptor cell stereocilium organization

developmental process [inference]

anatomical structure formation involved in morphogenesis [inference]

tube formation [inference]

tube closure [inference]

neural tube closure

anatomical structure development [inference]

tissue development [inference]

epithelium development [inference]

kidney epithelium development [inference]

mesonephric epithelium development [inference]

mesonephric tubule development [inference]

ureteric bud development

tube development [inference]

mesonephric tubule development [inference]

ureteric bud development

response to stimulus [inference]

response to stress [inference]

response to wounding [inference]

wound healing

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of localization [inference]

regulation of transport [inference]

regulation of secretion [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of locomotion [inference]

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

positive regulation of transport [inference]

positive regulation of secretion [inference]

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular process [inference]

regulation of cell adhesion [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell-substrate adhesion [inference]

regulation of cell-matrix adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of cell-cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of leukocyte cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

regulation of actin filament-based process [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of cell population proliferation [inference]

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of leukocyte proliferation [inference]

regulation of mononuclear cell proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of cellular component biogenesis [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of organelle assembly [inference]

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of extracellular exosome assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cellular process [inference]

positive regulation of cellular component biogenesis [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of exosomal secretion

positive regulation of cell adhesion [inference]

positive regulation of cell-substrate adhesion [inference]

positive regulation of cell-matrix adhesion [inference]

positive regulation of focal adhesion assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

negative regulation of cellular process [inference]

negative regulation of cell adhesion [inference]

negative regulation of cell-cell adhesion [inference]

negative regulation of leukocyte cell-cell adhesion [inference]

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell population proliferation [inference]

negative regulation of leukocyte proliferation [inference]

negative regulation of mononuclear cell proliferation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of cellular component organization [inference]

regulation of organelle organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of cytoskeleton organization [inference]

regulation of actin cytoskeleton organization [inference]

regulation of actomyosin structure organization [inference]

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of organelle assembly [inference]

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

regulation of extracellular exosome assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cellular component organization [inference]

positive regulation of organelle organization [inference]

positive regulation of cytoskeleton organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

positive regulation of organelle assembly [inference]

positive regulation of extracellular exosome assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of cell-substrate junction organization [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell-substrate junction organization [inference]

positive regulation of focal adhesion assembly

regulation of cell junction assembly [inference]

regulation of cell-substrate junction assembly [inference]

regulation of focal adhesion assembly [inference]

positive regulation of focal adhesion assembly

positive regulation of cell junction assembly [inference]

positive regulation of focal adhesion assembly

regulation of supramolecular fiber organization [inference]

regulation of actin filament organization [inference]

regulation of actin filament bundle assembly [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of stress fiber assembly [inference]

positive regulation of stress fiber assembly

positive regulation of supramolecular fiber organization [inference]

positive regulation of actin filament bundle assembly [inference]

positive regulation of stress fiber assembly

regulation of vesicle-mediated transport [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

regulation of secretion by cell [inference]

regulation of exocytosis [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of exosomal secretion [inference]

positive regulation of exosomal secretion

positive regulation of secretion by cell [inference]

positive regulation of exocytosis [inference]

positive regulation of exosomal secretion

regulation of cell motility [inference]

regulation of cell migration [inference]

regulation of fibroblast migration

regulation of multicellular organismal process [inference]

regulation of cell activation [inference]

regulation of leukocyte activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

regulation of lymphocyte activation [inference]

regulation of lymphocyte proliferation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

regulation of T cell activation [inference]

regulation of T cell proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

negative regulation of multicellular organismal process [inference]

negative regulation of cell activation [inference]

negative regulation of leukocyte activation [inference]

negative regulation of lymphocyte activation [inference]

negative regulation of lymphocyte proliferation [inference]

negative regulation of T cell proliferation

negative regulation of T cell activation [inference]

negative regulation of T cell proliferation

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISO	GO_REF
extracellular region	EXP	PMID
extracellular region	IEA	GO_REF
Golgi lumen	TAS	Reactome
focal adhesion	ISO	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cell junction [inference]

anchoring junction [inference]

cell-substrate junction [inference]

focal adhesion

membrane-enclosed lumen [inference]

organelle lumen [inference]

intracellular organelle lumen [inference]

Golgi lumen

costamere

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
fibronectin binding	ISO	GO_REF
fibronectin binding	IEA	GO_REF
protein kinase C binding	ISO	GO_REF
protein kinase C binding	IEA	GO_REF
identical protein binding	ISO	GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

fibronectin binding

enzyme binding [inference]

kinase binding [inference]

protein kinase binding [inference]

protein kinase C binding

identical protein binding

molecular transducer activity [inference]

signaling receptor activity [inference]

thrombospondin receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAPACLLAPLLLLLLGGFPLVPGESIRETEVIDPQDLLEGRYFSGALPDDEDAGGSDDFELSGSGDLDDTEEPRPFPEVIEPLVPLDNHIPENAQPGIRVPSEPKELEENEVIPKRAPSDVGDDMSNKVSMSSTAQGSNIFERTEVLAALIVGGVVGILFAVFLILLLVYRMKKKDEGSYDLGKKPIYKKAPTNEFYA

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 3** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
44	O-linked (Xyl...) (glycosaminoglycan) serine			UniProt GlyGen
62	O-linked (Xyl...) (glycosaminoglycan) serine			UniProt GlyGen
64	O-linked (Xyl...) (glycosaminoglycan) serine			UniProt GlyGen

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 7** entries
Pathway Name	Organism
Glycosaminoglycan-protein linkage region biosynthesis	Mus musculus
HS-GAG biosynthesis	Mus musculus
HS-GAG degradation	Mus musculus
Initiation of coagulation cascade	Mus musculus
Regulation of clotting cascade	Mus musculus
Retinoid metabolism and transport	Mus musculus
Syndecan interactions	Mus musculus

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026