GlyCosmos Portal

GlyTouCan

Glycan Structure Repository

GlyComb

Glycoconjugate Repository

GlycoPOST

Glycomics MS raw data Repository

UniCarb-DR

Glycomics MS Repository for glycan annotations from GlycoWorkbench

LM-GlycoRepo

Repository for lectin-assisted multimodality data

All Resources

Genes / Proteins / Lipids Glycans / Glycoconjugates Glycomes Pathways / Interactions / Diseases / Organisms

Other Information

Release Statistics Download

Tools

Glycan Converters

LM-GlycomeAtlas

Search Tools

Cross Search Glycan Search Publication Search Programmatic Access

Guidelines

MIRAGE

L-pipecolate oxidase

Summary

UniProt ID: O43029
Gene Symbol: SPBC354.15 fap1
Gene ID: 2540916
Organism: Schizosaccharomyces pombe 972h-

External Links

PubChem: O43029
Re-Glyco: O43029

Annotation

Keyword: Cytoplasm FAD Glycoprotein Nucleus Oxidoreductase Reference proteome Secreted Signal

Gene Ontology (GO)

Displaying 1 entry
GO Term	Evidence Code	Reference
L-lysine catabolic process

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

amino acid catabolic process [inference]

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

primary metabolic process [inference]

amino acid metabolic process [inference]

amino acid catabolic process [inference]

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

proteinogenic amino acid metabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

small molecule metabolic process [inference]

organic acid metabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

oxoacid metabolic process [inference]

carboxylic acid metabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

proteinogenic amino acid metabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid metabolic process [inference]

L-amino acid metabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

small molecule catabolic process [inference]

organic acid catabolic process [inference]

carboxylic acid catabolic process [inference]

proteinogenic amino acid catabolic process [inference]

L-lysine catabolic process

alpha-amino acid catabolic process [inference]

L-amino acid catabolic process [inference]

L-lysine catabolic process

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	IEA	GO_REF
nucleus	IEA	GO_REF
nucleus	HDA	PMID
cytosol	HDA	PMID

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
proline dehydrogenase activity	IDA	PMID
proline dehydrogenase activity	IBA	GO_REF
sarcosine oxidase activity	IDA	PMID
L-pipecolate oxidase activity	IDA	PMID
L-pipecolate oxidase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

oxidoreductase activity, acting on the CH-NH group of donors [inference]

oxidoreductase activity, acting on the CH-NH group of donors, oxygen as acceptor [inference]

oxidoreductase activity, acting on the CH-NH group of donors, quinone or similar compound as acceptor [inference]

proline dehydrogenase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

flavin adenine dinucleotide binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

flavin adenine dinucleotide binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

flavin adenine dinucleotide binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVKNTSVIIVGAGVFGLSAALELTKRGGYTIKILDRAPPPVIDGSSVDANRIIRSDYADAVYCSMGIDALEEWRTNPLFKEQFYGSGLMFVGRDNVEYRDMSLENLTKMGVSAAKFQTTEELRKLFPKWIGELNDGEAGYANFSSGWANAEQSVKSVVNYLAHAGVSFISGPEGTVEELITEENVVKGVRTTTGAYMAEKLIFATGAWTASLLPNDHTRFLATGQPVAYIKLTPEEYIRFLTNPVYLDFDTGFYIFPPTPDGYLKFARHGYGFTRMQNLKSGKVESVPPKKPLVSPILPKEAELDLRRNLQRTYGEEISQRPFYKTRICYYTDTADAEFVFDYHPDYENLFVCTGGSGHGFKFFPILGKYSIGCMFRELEEPLLKKWRWKKENLEFAALDHSRAGPSRQELS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
105	N-linked (GlcNAc...) asparagine			UniProt
142	N-linked (GlcNAc...) asparagine			UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Lysine catabolism	Schizosaccharomyces pombe
Peroxisomal protein import	Schizosaccharomyces pombe

About Release Notes Help Feedback

Click here to visit the beta site.

International Collaboration

GlyCosmos is a member of the GlySpace Alliance together with GlyGen and Glycomics@ExPASy.

Acknowledgements

Supported by JST NBDC Grant Number JPMJND2204

Partly supported by NIH Common Fund Grant #1U01GM125267-01

Logo License Policies Site Map

Contact: [email protected]

GlyCosmos Portal v4.5.0

Last updated: April 6, 2026