GlyCosmos Portal

Submissions

RNA-binding protein Musashi homolog 1

Summary

UniProt ID: O43347
Gene Symbol: MSI1
Gene ID: 4440
Organism: Homo sapiens (human)

External Links

GlyGen: O43347
PubChem: O43347
The O-GlcNAc Database: O43347
O-GlcNAcAtlas: O43347
Re-Glyco: O43347

Annotation

Keyword: Acetylation Cytoplasm Nucleus Phosphoprotein Proteomics identification RNA-binding Reference proteome Repeat

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
regulation of translation	IBA	GO_REF
nervous system development	TAS	PMID
central nervous system development	IBA	GO_REF
response to hormone	IEA	GO_REF
epithelial cell differentiation	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation

developmental process [inference]

anatomical structure development [inference]

system development [inference]

cellular developmental process [inference]

cell differentiation [inference]

epithelial cell differentiation

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone

response to chemical [inference]

response to hormone

biological regulation [inference]

regulation of biological process [inference]

regulation of cellular process [inference]

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

post-transcriptional regulation of gene expression [inference]

regulation of translation

regulation of protein metabolic process [inference]

regulation of translation

regulation of primary metabolic process [inference]

regulation of protein metabolic process [inference]

regulation of translation

Displaying **all 5** entries
GO Term	Evidence Code	Reference
nucleus	ISS	GO_REF
nucleus	IEA	GO_REF GO_REF
cytoplasm	ISS	GO_REF
cytoplasm	IBA	GO_REF
cytoplasm	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytoplasm

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
RNA binding	TAS	PMID
RNA binding	IEA	GO_REF
RNA binding	HDA	PMID
mRNA binding
poly(U) RNA binding	IEA	GO_REF

GO Hierarchy

molecular function

binding [inference]

nucleic acid binding [inference]

RNA binding

single-stranded RNA binding [inference]

poly-pyrimidine tract binding [inference]

poly(U) RNA binding

mRNA binding

protein binding [inference]

identical protein binding

protein homodimerization activity

protein dimerization activity [inference]

protein homodimerization activity

molecular adaptor activity [inference]

protein-macromolecule adaptor activity [inference]

molecular condensate scaffold activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites