GlyCosmos Portal

Submissions

Ribonuclease K6

Summary

UniProt ID: O46527
Gene Symbol: RNASE6
Gene ID
Organism: Papio hamadryas (hamadryas baboon)

External Links

PubChem: O46527
Re-Glyco: O46527

Annotation

Keyword: Antibiotic Disulfide bond Endonuclease Glycoprotein Lysosome Secreted Signal

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
antibacterial humoral response	IEA	GO_REF
innate immune response	IEA	GO_REF
defense response to Gram-negative bacterium	IEA	GO_REF
defense response to Gram-positive bacterium	IEA	GO_REF
antimicrobial humoral immune response mediated by antimicrobial peptide	IEA	GO_REF

GO Hierarchy

biological process

immune system process [inference]

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

innate immune response

biological process involved in interspecies interaction between organisms [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response

response to stimulus [inference]

response to stress [inference]

defense response [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response

immune response [inference]

humoral immune response [inference]

antimicrobial humoral response [inference]

innate immune response

response to external stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response

response to biotic stimulus [inference]

response to external biotic stimulus [inference]

response to other organism [inference]

response to bacterium [inference]

defense response to bacterium [inference]

defense response to other organism [inference]

defense response to symbiont [inference]

antimicrobial humoral response [inference]

innate immune response

Displaying **all 3** entries
GO Term	Evidence Code	Reference
obsolete extracellular space
lysosome	ISS	GO_REF
lysosome	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying **all 4** entries
GO Term	Evidence Code	Reference
nucleic acid binding	IEA	GO_REF
endonuclease activity
RNA nuclease activity	IEA	GO_REF GO_REF
hydrolase activity

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity

catalytic activity, acting on a nucleic acid [inference]

nuclease activity [inference]

catalytic activity, acting on RNA [inference]

RNA nuclease activity

binding [inference]

nucleic acid binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MVLCFPLLLLLLVLWGPVCLLHAWPKHLTRAHWFEIQHIQPSPLQCNRAMSGINNYTQHCKHQNTFLHDSFQNVAAVCDLLSIICKNRQHNCHQSSKPVNMTDCRLTSGKYPQCRYSTAAQYKFFIVACDPPQKSDPPYKLVPVHLDSIL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites