GlyCosmos Portal

Submissions

Growth hormone receptor

Summary

UniProt ID: O46600
Gene Symbol: GHR
Gene ID: 280805
Organism: Bos taurus (domestic cattle)

External Links

Re-Glyco: O46600

Annotation

Keyword: Cell membrane Disulfide bond Endocytosis Glycoprotein Phosphoprotein Receptor Reference proteome Secreted Signal Transmembrane helix Ubl conjugation

Gene Ontology (GO)

Displaying **all 5** entries
GO Term	Evidence Code	Reference
endocytosis
positive regulation of cell population proliferation	IBA	GO_REF
cytokine-mediated signaling pathway	IBA	GO_REF
positive regulation of receptor signaling pathway via JAK-STAT	IBA	GO_REF
growth hormone receptor signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

growth hormone receptor signaling pathway

cytokine-mediated signaling pathway

vesicle-mediated transport [inference]

endocytosis

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis

import into cell [inference]

endocytosis

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of cellular process [inference]

signal transduction [inference]

cell surface receptor signaling pathway [inference]

enzyme-linked receptor protein signaling pathway [inference]

cell surface receptor protein tyrosine kinase signaling pathway [inference]

growth hormone receptor signaling pathway

cytokine-mediated signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of receptor signaling pathway via STAT [inference]

regulation of receptor signaling pathway via JAK-STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

regulation of cell population proliferation [inference]

positive regulation of cell population proliferation

positive regulation of cellular process [inference]

positive regulation of cell population proliferation

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of receptor signaling pathway via STAT [inference]

positive regulation of receptor signaling pathway via JAK-STAT

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
extracellular region	ISS	GO_REF
extracellular region	IEA	GO_REF
cytosol	IDA	PMID
cytosol	IBA	GO_REF
external side of plasma membrane	IBA	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex [inference]

growth hormone receptor complex

cellular anatomical structure [inference]

side of membrane [inference]

external side of plasma membrane

Displaying **all 3** entries
GO Term	Evidence Code	Reference
growth hormone receptor activity	IBA	GO_REF
peptide hormone binding	IBA	GO_REF
cytokine binding	IBA	GO_REF

GO Hierarchy

molecular function

binding [inference]

protein binding [inference]

cytokine binding

hormone binding [inference]

peptide hormone binding

molecular transducer activity [inference]

signaling receptor activity [inference]

transmembrane signaling receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

immune receptor activity [inference]

cytokine receptor activity [inference]

growth hormone receptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MDLWQLLLTLAVAGSSDAFSGSEATPAFLVRASQSLQILYPVLETNSSGNPKFTKCRSPELETFSCHWTDGANHSLQSPGSVQMFYIRRDIQEWKECPDYVSAGENSCYFNSSYTSVWTPYCIKLTSNGGIVDHKCFSVEDIVQPDPPVGLNWTLLNISLTEIHADILVKWEPPPNTDVKMGWIILEYELHYKELNETQWKMMDPLMVTSVPMYSLRLDKEYEVRVRTRQRNTEKYGKFSEVLLITFPQMNPSACEEDFQFPWFLIIIFGILGLAVTLYLLIFSKQQRIKMLILPPVPVPKIKGIDPDLLKEGKLEEVNTILAIHDNYKHEFYNDDSWVEFIELDIDDPDEKTEGSDTDRLLSNDHEKSLNIFGAKDDDSGRTSCYEPDILEADFHVSDMCDGTSEVAQPQRLKGEADISCLDQKNQNNSPSNDAAPASQQPSVILVEENKPRPLLIGGTESTHQAVHTQLSNPSSLANIDFYAQVSDITPAGNVVLSPGQKNKTGNPQCDTHPEVVTPCQANFIVDNAYFCEVDAKKYIALAPHVEAESHVEPSFNQEDIYITTESLTTTAGRSGTAEHVPSSEIPVPDYTSIHIVQSPQGLVLNATALPLPDKEFLSSCGYVSTDQLNKIMP

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 6** entries
Position	Description	Source
46	N-linked (GlcNAc...) asparagine	UniProt
73	N-linked (GlcNAc...) asparagine	UniProt
111	N-linked (GlcNAc...) asparagine	UniProt
152	N-linked (GlcNAc...) asparagine	UniProt
157	N-linked (GlcNAc...) asparagine	UniProt
196	N-linked (GlcNAc...) asparagine	UniProt