GlyCosmos Portal

Submissions

E3 SUMO-protein ligase PIAS3

Summary

UniProt ID: O54714
Gene Symbol: Pias3
Gene ID: 229615
Organism: Mus musculus (house mouse)

External Links

PubChem: O54714
The O-GlcNAc Database: O54714
Re-Glyco: O54714

Annotation

Keyword: Alternative splicing Cytoplasm Isopeptide bond Nucleus Reference proteome Transcription regulation Transferase Ubl conjugation Ubl conjugation pathway Zinc-finger

Gene Ontology (GO)

Displaying entries **1 - 5** of 20 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
negative regulation of transcription by RNA polymerase II	IDA	PMID
negative regulation of transcription by RNA polymerase II	IBA	GO_REF
regulation of transcription by RNA polymerase II
positive regulation of gene expression	ISO	GO_REF
negative regulation of gene expression	IDA	PMID

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

macromolecule metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein sumoylation

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein sumoylation

macromolecule modification [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein sumoylation

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein sumoylation

primary metabolic process [inference]

protein metabolic process [inference]

protein modification process [inference]

peptidyl-amino acid modification [inference]

peptidyl-lysine modification [inference]

protein sumoylation

post-translational protein modification [inference]

protein modification by small protein conjugation or removal [inference]

protein modification by small protein conjugation [inference]

protein sumoylation

biological regulation [inference]

regulation of biological process [inference]

regulation of immune system process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of signaling [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

regulation of tumor necrosis factor-mediated signaling pathway

positive regulation of biological process [inference]

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

negative regulation of biological process [inference]

negative regulation of immune system process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of multicellular organismal process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

regulation of tumor necrosis factor-mediated signaling pathway

regulation of response to cytokine stimulus [inference]

regulation of cytokine-mediated signaling pathway [inference]

regulation of tumor necrosis factor-mediated signaling pathway

regulation of developmental process [inference]

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of developmental process [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cellular process [inference]

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of cytokine-mediated signaling pathway [inference]

regulation of tumor necrosis factor-mediated signaling pathway

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

regulation of macromolecule metabolic process [inference]

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein sumoylation [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of primary metabolic process [inference]

regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of RNA biosynthetic process [inference]

regulation of DNA-templated transcription [inference]

regulation of transcription by RNA polymerase II

negative regulation of transcription by RNA polymerase II

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

regulation of protein metabolic process [inference]

regulation of protein modification process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

regulation of post-translational protein modification [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

regulation of protein modification by small protein conjugation or removal [inference]

regulation of protein sumoylation [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

regulation of cell differentiation [inference]

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of cell development [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of protein metabolic process [inference]

positive regulation of protein modification process [inference]

positive regulation of post-translational protein modification [inference]

positive regulation of protein modification by small protein conjugation or removal [inference]

positive regulation of protein sumoylation

negative regulation of cellular process [inference]

negative regulation of metabolic process [inference]

negative regulation of biosynthetic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of macromolecule metabolic process [inference]

negative regulation of macromolecule biosynthetic process [inference]

negative regulation of gene expression

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of protein metabolic process [inference]

negative regulation of protein modification process [inference]

negative regulation of post-translational protein modification [inference]

negative regulation of protein modification by small protein conjugation or removal [inference]

negative regulation of protein sumoylation

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of nucleobase-containing compound metabolic process [inference]

negative regulation of RNA metabolic process [inference]

negative regulation of RNA biosynthetic process [inference]

negative regulation of DNA-templated transcription

negative regulation of transcription by RNA polymerase II

negative regulation of cell differentiation [inference]

negative regulation of cell development [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal process [inference]

negative regulation of multicellular organismal process [inference]

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of multicellular organismal development [inference]

regulation of hemopoiesis [inference]

regulation of myeloid cell differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of myeloid cell differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of leukocyte differentiation [inference]

regulation of myeloid leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of osteoclast differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

negative regulation of hemopoiesis [inference]

negative regulation of leukocyte differentiation [inference]

negative regulation of myeloid leukocyte differentiation [inference]

negative regulation of osteoclast differentiation

regulation of biological quality [inference]

regulation of membrane potential [inference]

positive regulation of membrane potential

Displaying entries **1 - 5** of 14 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
chromatin	IBA	GO_REF
nucleus	ISO	GO_REF
nucleus	EXP	PMID PMID
nucleus	IDA	PMID PMID
nucleus	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

cytosol [inference]

cell junction [inference]

synapse [inference]

glutamatergic synapse

cell projection [inference]

plasma membrane bounded cell projection [inference]

neuron projection [inference]

dendrite

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

membraneless organelle [inference]

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

nucleus

intracellular membraneless organelle [inference]

nuclear body [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

supramolecular complex [inference]

ribonucleoprotein granule [inference]

nuclear ribonucleoprotein granule [inference]

nuclear speck

Displaying entries **1 - 5** of 9 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
transcription coregulator activity	IBA	GO_REF
zinc ion binding	IEA	GO_REF
potassium channel regulator activity	ISO	GO_REF
SUMO transferase activity	ISO	GO_REF
SUMO transferase activity	IDA	PMID

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

acyltransferase activity [inference]

aminoacyltransferase activity [inference]

ubiquitin-like protein transferase activity [inference]

SUMO transferase activity

SUMO ligase activity

ubiquitin-like protein ligase activity [inference]

SUMO ligase activity

catalytic activity, acting on a protein [inference]

ubiquitin-like protein transferase activity [inference]

SUMO transferase activity

SUMO ligase activity

ubiquitin-like protein ligase activity [inference]

SUMO ligase activity

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

glutamate receptor binding [inference]

ionotropic glutamate receptor binding

transmembrane transporter binding

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

molecular function regulator activity [inference]

transporter regulator activity [inference]

channel regulator activity [inference]

ion channel regulator activity [inference]

potassium channel regulator activity

transcription regulator activity [inference]

transcription coregulator activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MAELGELKHMVMSFRVSELQVLLGFAGRNKSGRKHELLAKALHLLKSSCAPSVQMKIKELYRRRFPRKTLGPSDLSLLSLPPGTSPVGSPGPLAPIPPTLLTPGTLLGPKREVDMHPPLPQPVHPDVTMKPLPFYEVYGELIRPTTLASTSSQRFEEAHFTFALTPQQLQQILTSREVLPGAKCDYTIQVQLRFCLCETSCPQEDYFPPNLFVKVNGKLCPLPGYLPPTKNGAEPKRPSRPINITPLARLSATVPNTIVVNWSSEFGRNYSLSVYLVRQLTAGTLLQKLRAKGIRNPDHSRALIKEKLTADPDSEVATTSLRVSLMCPLGKMRLTVPCRALTCAHLQSFDAALYLQMNEKKPTWTCPVCDKKAPYESLIIDGLFMEILNSCSDCDEIQFMEDGSWCPMKPKKEASEVCPPPGYGLDGLQYSAVQEGIQPESKKRVEVIDLTIESSSDEEDLPPTKKHCPVTSAAIPALPGSKGALTSGHQPSSVLRSPAMGTLGSDFLSSLPLHEYPPAFPLGADIQGLDLFSFLQTESQHYGPSVITSLDEQDTLGHFFQYRGTPSHFLGPLAPTLGSSHRSSTPAPPPGRVSSIVAPGSSLREGHGGPLPSGPSLTGCRSDVISLD

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	PubMed ID	GlyTouCan ID	Source
309	36852467	G49108TO	The O-GlcNAc Database
314	36852467	G49108TO	The O-GlcNAc Database
318	36852467	G49108TO	The O-GlcNAc Database
471	36852467	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 6** entries
Pathway Name	Organism
Formation of Incision Complex in GG-NER	Mus musculus
SUMOylation of DNA replication proteins	Mus musculus
SUMOylation of immune response proteins	Mus musculus
SUMOylation of intracellular receptors	Mus musculus
SUMOylation of transcription cofactors	Mus musculus
SUMOylation of transcription factors	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements