GlyCosmos Portal

Submissions

Matrix metalloproteinase-20

Summary

UniProt ID: O60882
Gene Symbol: MMP20
Gene ID: 9313
Organism: Homo sapiens (human)

External Links

PubChem: O60882
The Human Metabolome Database: HMDBP02615
The O-GlcNAc Database: O60882
Re-Glyco: O60882

Annotation

Keyword: 3D-structure Amelogenesis imperfecta Autocatalytic cleavage Calcium Disulfide bond Extracellular matrix Metal-binding Metalloprotease Reference proteome Repeat Signal Zinc Zymogen

Gene Ontology (GO)

Displaying entries **1 - 5** of 8 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
proteolysis	TAS	PMID
proteolysis	IEA	GO_REF GO_REF
extracellular matrix disassembly
protein catabolic process
extracellular matrix organization	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

catabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

collagen catabolic process

collagen metabolic process [inference]

collagen catabolic process

macromolecule metabolic process [inference]

macromolecule catabolic process [inference]

protein catabolic process

protein metabolic process [inference]

primary metabolic process [inference]

protein metabolic process [inference]

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component disassembly [inference]

extracellular matrix disassembly

extracellular structure organization [inference]

extracellular matrix organization

extracellular matrix disassembly

external encapsulating structure organization [inference]

extracellular matrix organization

extracellular matrix disassembly

developmental process [inference]

anatomical structure morphogenesis [inference]

animal organ morphogenesis [inference]

odontogenesis [inference]

odontogenesis of dentin-containing tooth [inference]

amelogenesis

anatomical structure formation involved in morphogenesis [inference]

amelogenesis

biological regulation [inference]

regulation of biological process [inference]

regulation of developmental process [inference]

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of tooth mineralization [inference]

regulation of enamel mineralization

regulation of multicellular organismal process [inference]

regulation of multicellular organismal development [inference]

regulation of biomineral tissue development [inference]

regulation of tooth mineralization [inference]

regulation of enamel mineralization

Displaying **all 4** entries
GO Term	Evidence Code	Reference
extracellular region	TAS	PMID Reactome
extracellular region	IEA	GO_REF
obsolete extracellular space
extracellular matrix	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

extracellular region

external encapsulating structure [inference]

extracellular matrix

Displaying **all 5** entries
GO Term	Evidence Code	Reference
metalloendopeptidase activity	TAS	PMID
metalloendopeptidase activity	IDA	PMID
metalloendopeptidase activity	IEA	GO_REF
zinc ion binding	TAS	PMID
zinc ion binding	IEA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

hydrolase activity [inference]

peptidase activity [inference]

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

catalytic activity, acting on a protein [inference]

peptidase activity [inference]

endopeptidase activity [inference]

metalloendopeptidase activity

metallopeptidase activity [inference]

metalloendopeptidase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding [inference]

transition metal ion binding [inference]

zinc ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying 1 entry
Position	Description	PubMed ID	GlyTouCan ID	Source
67		38253038	G49108TO	The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 3** entries
Pathway Name	Organism
Assembly of collagen fibrils and other multimeric structures	Homo sapiens
Collagen degradation	Homo sapiens
Degradation of the extracellular matrix	Homo sapiens

Disease

Displaying 1 entry
DO ID	Disease Name	Source
DOID:0110060	amelogenesis imperfecta hypomaturation type 2A2	Alliance of Genome Resources

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements