GlyCosmos Portal

Annotation

Keyword: 3D-structure Cell membrane Disulfide bond Glycoprotein Proteomics identification Receptor Reference proteome Signal Transmembrane helix Transport

Gene Ontology (GO)

Displaying entries **1 - 5** of 32 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
positive regulation of receptor recycling	IDA	PMID
calcium ion transport	IDA	PMID
calcium ion transport	IBA	GO_REF
intracellular protein transport	IEA	GO_REF
G protein-coupled receptor signaling pathway	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

G protein-coupled receptor signaling pathway involved in heart process

calcitonin family receptor signaling pathway [inference]

amylin receptor signaling pathway

amylin receptor 3 signaling pathway

adrenomedullin receptor signaling pathway

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to estradiol stimulus

response to stimulus [inference]

response to endogenous stimulus [inference]

response to hormone [inference]

cellular response to hormone stimulus

cellular response to endogenous stimulus [inference]

cellular response to hormone stimulus

response to chemical [inference]

response to hormone [inference]

cellular response to hormone stimulus

response to lipid [inference]

response to estradiol [inference]

cellular response to estradiol stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to estradiol stimulus

response to nitrogen compound [inference]

response to amyloid-beta

response to oxygen-containing compound [inference]

response to estradiol [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to estradiol stimulus

response to amyloid-beta

cellular response to stimulus [inference]

cellular response to chemical stimulus [inference]

cellular response to hormone stimulus

cellular response to lipid [inference]

cellular response to estradiol stimulus

cellular response to oxygen-containing compound [inference]

cellular response to estradiol stimulus

localization [inference]

macromolecule localization [inference]

intracellular protein localization [inference]

protein transport

intracellular protein transport

protein localization to membrane [inference]

protein localization to plasma membrane

protein localization to cell periphery [inference]

protein localization to plasma membrane

establishment of localization [inference]

transport [inference]

monoatomic ion transport [inference]

monoatomic cation transport [inference]

metal ion transport [inference]

calcium ion transport

protein transport

intracellular protein transport

vesicle-mediated transport [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

intracellular transport [inference]

intracellular protein transport

import into cell [inference]

endocytosis [inference]

receptor-mediated endocytosis [inference]

receptor internalization

establishment of protein localization [inference]

protein transport

intracellular protein transport

establishment of localization in cell [inference]

intracellular transport [inference]

intracellular protein transport

cellular localization [inference]

intracellular transport [inference]

intracellular protein transport

localization within membrane [inference]

protein localization to membrane [inference]

protein localization to plasma membrane

biological regulation [inference]

regulation of biological process [inference]

regulation of signaling [inference]

regulation of receptor recycling [inference]

positive regulation of receptor recycling

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

negative regulation of signaling receptor activity [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of signaling [inference]

positive regulation of receptor recycling

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of localization [inference]

regulation of protein localization [inference]

positive regulation of protein localization [inference]

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to cell periphery [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of biological process [inference]

positive regulation of signaling [inference]

positive regulation of receptor recycling

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of receptor recycling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of protein localization [inference]

positive regulation of protein localization to cell periphery [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of response to stimulus [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

negative regulation of signaling receptor activity [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of response to stimulus [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of cellular process [inference]

signal transduction [inference]

G protein-coupled receptor signaling pathway

adenylate cyclase-modulating G protein-coupled receptor signaling pathway [inference]

adenylate cyclase-activating G protein-coupled receptor signaling pathway

G protein-coupled receptor signaling pathway involved in heart process

calcitonin family receptor signaling pathway [inference]

amylin receptor signaling pathway

amylin receptor 3 signaling pathway

adrenomedullin receptor signaling pathway

regulation of cell communication [inference]

regulation of signal transduction [inference]

regulation of G protein-coupled receptor signaling pathway [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of signaling receptor activity [inference]

negative regulation of signaling receptor activity [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

regulation of intracellular signal transduction [inference]

regulation of MAPK cascade [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of ERK1 and ERK2 cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of calcium-mediated signaling [inference]

positive regulation of calcium-mediated signaling

regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction [inference]

positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction

regulation of cAMP/PKA signal transduction [inference]

positive regulation of cAMP/PKA signal transduction

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

regulation of metabolic process [inference]

regulation of biosynthetic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of receptor recycling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

regulation of macromolecule metabolic process [inference]

regulation of receptor recycling [inference]

positive regulation of receptor recycling

regulation of macromolecule biosynthetic process [inference]

regulation of gene expression [inference]

positive regulation of gene expression

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of receptor recycling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cellular process [inference]

positive regulation of metabolic process [inference]

positive regulation of biosynthetic process [inference]

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of macromolecule metabolic process [inference]

positive regulation of receptor recycling

positive regulation of macromolecule biosynthetic process [inference]

positive regulation of gene expression

positive regulation of cell communication [inference]

positive regulation of signal transduction [inference]

positive regulation of intracellular signal transduction [inference]

positive regulation of MAPK cascade [inference]

positive regulation of ERK1 and ERK2 cascade

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of cellular localization [inference]

regulation of protein localization to membrane [inference]

regulation of protein localization to plasma membrane [inference]

positive regulation of protein localization to plasma membrane

positive regulation of protein localization to membrane [inference]

positive regulation of protein localization to plasma membrane

regulation of molecular function [inference]

regulation of signaling receptor activity [inference]

negative regulation of signaling receptor activity [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

negative regulation of molecular function [inference]

negative regulation of signaling receptor activity [inference]

cross-receptor inhibition within G protein-coupled receptor heterodimer

Displaying entries **1 - 5** of 12 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
lysosome	TAS	PMID
lysosome	IDA	PMID
plasma membrane	EXP	PMID
plasma membrane	TAS	PMID Reactome Reactome Reactome Reactome Reactome Reactome
plasma membrane	IDA	PMID PMID PMID GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

signaling receptor complex

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex [inference]

G protein-coupled receptor dimeric complex [inference]

adrenomedullin receptor complex

calcitonin family receptor complex [inference]

adrenomedullin receptor complex

amylin receptor complex [inference]

amylin receptor complex 3

membrane protein complex [inference]

plasma membrane protein complex [inference]

plasma membrane signaling receptor complex [inference]

G protein-coupled receptor complex [inference]

G protein-coupled receptor dimeric complex [inference]

adrenomedullin receptor complex

calcitonin family receptor complex [inference]

adrenomedullin receptor complex

amylin receptor complex [inference]

amylin receptor complex 3

cellular anatomical structure [inference]

cell surface

membrane [inference]

plasma membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

vacuole [inference]

lytic vacuole [inference]

lysosome

Displaying entries **1 - 5** of 6 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
amyloid-beta binding	IC	PMID
adrenomedullin receptor activity	IPI	PMID
coreceptor activity	IDA	PMID PMID
coreceptor activity	IBA	GO_REF
coreceptor activity	IEA	GO_REF GO_REF GO_REF

GO Hierarchy

molecular function

binding [inference]

peptide binding [inference]

amyloid-beta binding

molecular transducer activity [inference]

signaling receptor activity [inference]

peptide receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

calcitonin family receptor activity [inference]

transmembrane signaling receptor activity [inference]

G protein-coupled receptor activity [inference]

G protein-coupled peptide receptor activity [inference]

calcitonin family receptor activity [inference]

coreceptor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
29	N-linked (GlcNAc...) asparagine			UniProt GlyGen
58	N-linked (GlcNAc...) asparagine			UniProt GlyGen
71	N-linked (GlcNAc...) asparagine			UniProt GlyGen
103	N-linked (GlcNAc...) asparagine	37074911	G70232NH G83460ZZ G80920RR G62765YT	UniProt GlyGen