GlyCosmos Portal

Submissions

Unconventional myosin-Ia

Summary

UniProt ID: O88329
Gene Symbol: Bbmi Myhl Myo1a
Gene ID: 432516
Organism: Mus musculus (house mouse)

External Links

GlyGen: O88329
The O-GlcNAc Database: O88329
O-GlcNAcAtlas: O88329
Re-Glyco: O88329

Annotation

Keyword: ATP-binding Actin-binding Calmodulin-binding Cell projection Myosin Phosphoprotein Reference proteome Repeat

Gene Ontology (GO)

Displaying entries **1 - 5** of 13 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
endocytosis	IBA	GO_REF
actin filament organization
sensory perception of sound	ISS	GO_REF
sensory perception of sound	ISO	GO_REF
sensory perception of sound	IBA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

vesicle-mediated transport [inference]

endocytosis

actin filament-based process [inference]

actin filament-based movement

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cellular component assembly [inference]

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

microvillus assembly

cell projection organization

cell projection assembly [inference]

plasma membrane bounded cell projection assembly [inference]

microvillus assembly

plasma membrane bounded cell projection organization [inference]

microvillus organization [inference]

microvillus assembly

plasma membrane bounded cell projection assembly [inference]

microvillus assembly

supramolecular fiber organization [inference]

actin filament organization

multicellular organismal process [inference]

system process [inference]

nervous system process [inference]

sensory perception [inference]

sensory perception of mechanical stimulus [inference]

sensory perception of sound

localization [inference]

establishment of localization [inference]

transport [inference]

vesicle-mediated transport [inference]

endocytosis

import into cell [inference]

endocytosis

organelle localization [inference]

vesicle localization

biological regulation [inference]

regulation of biological process [inference]

regulation of localization [inference]

regulation of protein localization

Displaying entries **1 - 5** of 42 in total

1

2

3

4

5

…

Next ›

Last »
GO Term	Evidence Code	Reference
cytoplasm	ISS	GO_REF
cytoplasm	ISO	GO_REF
cytoplasm	IEA	GO_REF
plasma membrane	IBA	GO_REF
microvillus	ISS	GO_REF

GO Hierarchy

cellular component

protein-containing complex [inference]

cellular anatomical structure [inference]

cytoplasm

membrane [inference]

plasma membrane

plasma membrane region [inference]

membrane microdomain [inference]

membrane raft [inference]

plasma membrane raft

lateral plasma membrane

site of polarized growth [inference]

growth cone

cell leading edge

cell projection [inference]

plasma membrane bounded cell projection [inference]

actin-based cell projection [inference]

microvillus

organelle [inference]

membraneless organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

cortical cytoskeleton [inference]

cortical actin cytoskeleton

intracellular organelle [inference]

intracellular membraneless organelle [inference]

cytoskeleton [inference]

actin cytoskeleton

cortical cytoskeleton [inference]

cortical actin cytoskeleton

cell body [inference]

neuronal cell body

cluster of actin-based cell projections [inference]

brush border

Displaying **all 5** entries
GO Term	Evidence Code	Reference
microfilament motor activity
calmodulin binding
ATP binding	IEA	GO_REF
actin filament binding	IDA	PMID
actin filament binding	IBA	GO_REF

GO Hierarchy

molecular function

cytoskeletal motor activity [inference]

microfilament motor activity

catalytic activity [inference]

isomerase activity [inference]

macromolecular conformation isomerase activity [inference]

polypeptide conformation or assembly isomerase activity [inference]

microfilament motor activity

binding [inference]

protein binding [inference]

calmodulin binding

cytoskeletal protein binding [inference]

actin binding [inference]

actin filament binding

small molecule binding [inference]

ion binding [inference]

anion binding [inference]

purine ribonucleoside triphosphate binding [inference]

ATP binding

heterocyclic compound binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

protein-containing complex binding [inference]

actin filament binding

carbohydrate derivative binding [inference]

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

nucleoside phosphate binding [inference]

nucleotide binding [inference]

purine nucleotide binding [inference]

adenyl nucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

ribonucleotide binding [inference]

purine ribonucleotide binding [inference]

adenyl ribonucleotide binding [inference]

ATP binding

purine ribonucleoside triphosphate binding [inference]

ATP binding

ATP-dependent activity [inference]

microfilament motor activity

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MPLLEGPVGVEDLILLEPLDEESLIKNLQLRYENKEIYTYIGNVVISMNPYEQLPIYGPEFIAKYRDYTFYELKPHIYALANVAYQSLKDRDRDQCILITGESGAGKTEASKLVMSYVAAVCGKGEQVNSVKEQLLQSNPVLEAFGNAKTIRNNNSSRFGKYMDIEFDFKGSPLGGVITNYLLEKSRVVKQLKGERNFHIFYQLLAGADAQLLKALKLEEDTSVYGYLNGEVSKVNGMDDASNFRAVQHAMSVIGFSEEEIRQVLEVTALVLKLGNVKLTDEFQANGIPASGICDGKGIQEIGEMMGLNSTELERALCSRTMETGKEKVVTVLNVTQAQYARDALAKNIYSRLFDWIVKRINESIKVGTGEKKKVMGVLDIYGFEILEDNSFEQFVINYCNERLQQVFIELTLKEEQEEYKREGIPWTKVEYFDNGIICNLIEHSQRGILAMLDEECLRPGVVSDSTFLAKLNQLFSKHSHYESKVSQNAQRQYDRTMGLSCFRISHYAGKVTYNVTGFIDKNNDLLFRDLSQTMWKAQHPLLKSLFPEGNPKEASLKRPPTAGTQFKNSVAVLMKNLYSKNPNYIRCIKPNDQQQKGRFTSEMVMVQARYLGLLENVRVRRAGYAFRQGYKPFLERYRLLSRSTWPRWNGDDREGVEKVLGSLTLSSEELAYGKTKIFIRSPKTLFYLEEQRRLRLQQLATLIQKVYRGWRCRTHYQQMRKSQILISAWFRGNKQKKHYGKIRSSVLLIQAFVRGWRARKNYRKYFRSGAALTLANFIYQSMAQKFLLNLKKNLPSTKVLDNTWPAAPYRCFNTANQELQRLFYQWKCKKFRDQLSPKQVQTLREKLCASELFKGKKASYPQSVPIPFRGDYIGLQGNPKLQRLKGREEGPVLVADTVKKVNRGNGKTSARILLLTKGHVILTDAKKSQAQIVIGLEDVAGVSVSSLQDGLFSLHLSEMSSAVSKGDILLVSDHVVELLTKMYQAVLDATQRQLSVTVTEKFSVRFKEGSVAVKVIQGPEGGGNRKLICKKKGSNAMEVTVR

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 2** entries
Position	Description	PubMed ID	GlyTouCan ID	Source
309			G57489SP	GlyGen
723		30059200	G49108TO	GlyGen The O-GlcNAc Database

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements