GlyCosmos Portal

Submissions

Beta-1,4-galactosyltransferase 6

Summary

UniProt ID: O88419
Gene Symbol: B4galt6
Gene ID: 65196
Organism: Rattus norvegicus (Norway rat)

External Links

PubChem

O88419

SwissLipids

SLP:000000764

Re-Glyco

O88419

Annotation

Keyword: Calcium Direct protein sequencing Disulfide bond Glycoprotein Glycosyltransferase Golgi apparatus Lipid biosynthesis Magnesium Manganese Metal-binding Reference proteome Signal-anchor Sphingolipid metabolism Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
lactosylceramide biosynthetic process	ISO	GO_REF
lactosylceramide biosynthetic process	IEA	GO_REF
ganglioside biosynthetic process	ISS	GO_REF
ganglioside biosynthetic process	ISO	GO_REF
ganglioside biosynthetic process	IEA	GO_REF

GO Hierarchy

biological process

cellular process [inference]

ensheathment of neurons [inference]

axon ensheathment [inference]

axon ensheathment in central nervous system [inference]

central nervous system myelination

myelination [inference]

central nervous system myelination

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

ceramide biosynthetic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

primary metabolic process [inference]

carbohydrate metabolic process

lipid metabolic process [inference]

sphingolipid metabolic process [inference]

ceramide metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

ceramide biosynthetic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

ceramide biosynthetic process [inference]

lipid biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

sphingolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

ceramide biosynthetic process [inference]

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

carbohydrate derivative metabolic process [inference]

carbohydrate derivative biosynthetic process [inference]

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

liposaccharide metabolic process [inference]

glycolipid metabolic process [inference]

glycosphingolipid metabolic process [inference]

ganglioside metabolic process [inference]

ganglioside biosynthetic process

glycosphingolipid biosynthetic process

glycolipid biosynthetic process [inference]

glycosphingolipid biosynthetic process

cellular developmental process [inference]

cell maturation [inference]

neuron maturation

cellular component organization or biogenesis [inference]

cellular component organization [inference]

cell projection organization [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

axonogenesis [inference]

central nervous system neuron axonogenesis

developmental process [inference]

anatomical structure morphogenesis [inference]

cell projection morphogenesis [inference]

plasma membrane bounded cell projection morphogenesis [inference]

neuron projection morphogenesis [inference]

axonogenesis [inference]

central nervous system neuron axonogenesis

developmental maturation [inference]

anatomical structure maturation [inference]

cell maturation [inference]

neuron maturation

cellular developmental process [inference]

cell maturation [inference]

neuron maturation

Displaying **all 2** entries
GO Term	Evidence Code	Reference
Golgi apparatus	IBA	GO_REF
Golgi cisterna membrane	IEA	GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

Golgi cisterna membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

Golgi apparatus

Displaying entries **1 - 5** of 7 in total

1

2

Next ›

Last »
GO Term	Evidence Code	Reference
galactosyltransferase activity	ISO	GO_REF
galactosyltransferase activity	IEA	GO_REF
UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity	ISO	GO_REF
UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity	IDA	PMID
UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

transferase activity [inference]

glycosyltransferase activity [inference]

UDP-glycosyltransferase activity [inference]

UDP-galactosyltransferase activity [inference]

UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity

hexosyltransferase activity [inference]

galactosyltransferase activity

UDP-galactosyltransferase activity [inference]

UDP-galactose:glucosylceramide beta-1,4-galactosyltransferase activity

binding [inference]

small molecule binding [inference]

ion binding [inference]

cation binding [inference]

metal ion binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MSALKRMMRVSNRSLIAFIFFFSLSTSCLYFIYVAPGIANTYLFMVQARGIMLRENVKTIGHMIRLYTNKNTTLNGTDYPEGNNTSDYLVQTTTYLPQNFTYSPHLPCPEKLPYMRGFLSVNVSEISFDEVHQLFSKDSEIEPGGHWRPQDCKPRWKVAVLIPFRNRHEHLPIFFLHLIPMLQKQRLEFAFYVIEQTGTQPFNRAMLFNVGFKEAMKDRAWDCVIFHDVDHLPENDRNYYGCGEMPRHFAAKLDKYMYILPYKEFFGGVSGLTVEQFRKINGFPNAFWGWGGEDDDLWNRVHYSGYNVTRPEGDLGKYTSIPHHHRGEVQFLGRYKLLRYSKERQFIDGLNNLLYTPKILVDRLYTNISVNLMPELAPVEDY

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 8** entries
Position	Description	Source
71	N-linked (GlcNAc...) asparagine	UniProt
75	N-linked (GlcNAc...) asparagine	UniProt
83	N-linked (GlcNAc...) asparagine	UniProt
84	N-linked (GlcNAc...) asparagine	UniProt
99	N-linked (GlcNAc...) asparagine	UniProt
122	N-linked (GlcNAc...) asparagine	UniProt
307	N-linked (GlcNAc...) asparagine	UniProt
367	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 4** entries
Pathway Name	Organism
Glycosphingolipid biosynthesis	Rattus norvegicus
Keratan sulfate biosynthesis	Rattus norvegicus
N-Glycan antennae elongation	Rattus norvegicus
O-linked glycosylation of mucins	Rattus norvegicus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements