GlyCosmos Portal

Submissions

3-keto-steroid reductase/17-beta-hydroxysteroid dehydrogenase 7

Summary

UniProt ID: O88736
Gene Symbol: Hsd17b7 17hsd7
Gene ID: 15490
Organism: Mus musculus (house mouse)

External Links

PubChem

O88736

SwissLipids

SLP:000001215

Re-Glyco

O88736

Annotation

Keyword: Endoplasmic reticulum Glycoprotein NAD NADP Oxidoreductase Reference proteome Steroid biosynthesis Transmembrane helix

Gene Ontology (GO)

Displaying entries **1 - 5** of 18 in total

1

2

3

4

Next ›

Last »
GO Term	Evidence Code	Reference
cholesterol biosynthetic process	ISO	GO_REF
cholesterol biosynthetic process	IDA	PMID
cholesterol biosynthetic process	IBA	GO_REF
cholesterol biosynthetic process	IEA	GO_REF
estrogen biosynthetic process	ISO	GO_REF GO_REF

GO Hierarchy

biological process

cellular process [inference]

metabolic process [inference]

biosynthetic process [inference]

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

steroid hormone biosynthetic process [inference]

estrogen biosynthetic process

hormone biosynthetic process [inference]

estrogen biosynthetic process

small molecule biosynthetic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

hormone metabolic process [inference]

androgen metabolic process

estrogen metabolic process [inference]

estrogen biosynthetic process

hormone biosynthetic process [inference]

estrogen biosynthetic process

primary metabolic process [inference]

lipid metabolic process [inference]

steroid metabolic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

steroid hormone biosynthetic process [inference]

estrogen biosynthetic process

androgen metabolic process

estrogen metabolic process [inference]

estrogen biosynthetic process

sterol metabolic process [inference]

cholesterol metabolic process [inference]

cholesterol biosynthetic process

sterol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

zymosterol metabolic process [inference]

zymosterol biosynthetic process

lipid biosynthetic process [inference]

steroid biosynthetic process [inference]

sterol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

steroid hormone biosynthetic process [inference]

estrogen biosynthetic process

small molecule metabolic process [inference]

alcohol metabolic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

secondary alcohol metabolic process [inference]

cholesterol metabolic process [inference]

cholesterol biosynthetic process

zymosterol metabolic process [inference]

zymosterol biosynthetic process

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

small molecule biosynthetic process [inference]

alcohol biosynthetic process [inference]

secondary alcohol biosynthetic process [inference]

cholesterol biosynthetic process

zymosterol biosynthetic process

cellular developmental process [inference]

cell differentiation

developmental process [inference]

anatomical structure development [inference]

animal organ development [inference]

system development [inference]

skeletal system development [inference]

embryonic skeletal system development

nervous system development

cellular developmental process [inference]

cell differentiation

biological regulation [inference]

regulation of biological quality [inference]

regulation of hormone levels [inference]

hormone metabolic process [inference]

androgen metabolic process

estrogen metabolic process [inference]

estrogen biosynthetic process

hormone biosynthetic process [inference]

estrogen biosynthetic process

Displaying **all 5** entries
GO Term	Evidence Code	Reference
endoplasmic reticulum	IDA	PMID
endoplasmic reticulum membrane	ISO	GO_REF
endoplasmic reticulum membrane	IDA	PMID
endoplasmic reticulum membrane	IBA	GO_REF
endoplasmic reticulum membrane	IEA	GO_REF GO_REF

GO Hierarchy

cellular component

cellular anatomical structure [inference]

membrane [inference]

organelle membrane [inference]

endoplasmic reticulum membrane

organelle [inference]

membrane-bounded organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

intracellular organelle [inference]

intracellular membrane-bounded organelle [inference]

endoplasmic reticulum

Displaying entries **1 - 5** of 15 in total

1

2

3

Next ›

Last »
GO Term	Evidence Code	Reference
3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	ISO	GO_REF
3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	EXP	PMID
3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	IDA	PMID
3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	IMP	PMID PMID PMID
3-beta-hydroxysteroid 3-dehydrogenase (NADP+) activity	IBA	GO_REF

GO Hierarchy

molecular function

catalytic activity [inference]

oxidoreductase activity [inference]

steroid dehydrogenase activity [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

oxidoreductase activity, acting on CH-OH group of donors [inference]

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor [inference]

binding [inference]

protein binding [inference]

signaling receptor binding [inference]

cytokine receptor binding [inference]

prolactin receptor binding

Gene Ontology information from UniProt.

Annotation information from UniProt.

Sequence

MRKVVLITGASSGIGLALCGRLLAEDDDLHLCLACRNLSKARAVRDTLLASHPSAEVSIVQMDVSSLQSVVRGAEEVKQKFQRLDYLYLNAGILPNPQFNLKAFFCGIFSRNVIHMFTTAEGILTQNDSVTADGLQEVFETNLFGHFILIRELEPLLCHADNPSQLIWTSSRNAKKANFSLEDIQHSKGPEPYSSSKYATDLLNVALNRNFNQKGLYSSVMCPGVVMTNMTYGILPPFIWTLLLPIMWLLRFFVNALTVTPYNGAEALVWLFHQKPESLNPLTKYASATSGFGTNYVTGQKMDIDEDTAEKFYEVLLELEKRVRTTVQKSDHPS

N : N-glycosylation Site
___ : Potential Sequon

Glycosylation Sites

Displaying **all 4** entries
Position	Description	Source
37	N-linked (GlcNAc...) asparagine	UniProt
127	N-linked (GlcNAc...) asparagine	UniProt
178	N-linked (GlcNAc...) asparagine	UniProt
229	N-linked (GlcNAc...) asparagine	UniProt

Feature

: Glycosylation Site from GlyGen
: Glycosylation Site from UniProt

Pathway

Displaying **all 2** entries
Pathway Name	Organism
Cholesterol biosynthesis via desmosterol (Bloch pathway)	Mus musculus
Zymostenol biosynthesis via lathosterol (Kandutsch-Russell pathway)	Mus musculus

GlyTouCan

GlyComb

GlycoPOST

UniCarb-DR

LM-GlycoRepo

All Resources

Other Information

Tools

Search Tools

Guidelines

Summary

External Links

Annotation

International Collaboration

Acknowledgements